UniGene Name: sp_v3.0_unigene79795
Length: 141 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene79795
C |
Ace file of the UniGene sp_v3.0_unigene79795 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | glutamate dehydrogenase [Brassica napus] dbj|BAE45943.1| glutamate dehydrogenase 2 [Brassica napus] | - | - | 1.0e-10 | 82% |
| FL-Next | sp=Glutamate dehydrogenase; Pinus pinaster (Maritime pine). | - | - | 0.0 | 85% |
| Sma3 | Glutamate dehydrogenase | - | - | 2.961e-25 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Glutamate dehydrogenase. | EC:1.4.1.2 | - | 7.032e-13 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Alanine, aspartate and glutamate metabolism | 00250 | 7.032e-13 | % | |
| Sma3 | Arginine and proline metabolism | 00330 | 7.032e-13 | % | |
| Sma3 | Nitrogen metabolism | 00910 | 7.032e-13 | % | |
| Sma3 | Metabolic pathways | 01100 | 7.032e-13 | % | |
| Sma3 | Glutamate dehydrogenase (NAD(P)(+)). | EC:1.4.1.3 | - | 6.61e-39 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Alanine, aspartate and glutamate metabolism | 00250 | 6.61e-39 | % | |
| Sma3 | Arginine and proline metabolism | 00330 | 6.61e-39 | % | |
| Sma3 | D-Glutamine and D-glutamate metabolism | 00471 | 6.61e-39 | % | |
| Sma3 | Nitrogen metabolism | 00910 | 6.61e-39 | % | |
| Sma3 | Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid | 01064 | 6.61e-39 | % | |
| Sma3 | Metabolic pathways | 01100 | 6.61e-39 | % |
| Source | Gene names |
|---|---|
| Sma3 | AT5G07440; At3g03910; At5g07440; BoGDH; F20H23.4; GDH; GDH1; GDH2; GDH3; GDHA; GDHB; GSH3; GSVIVT00014097001; GSVIVT00014104001; GSVIVT00025474001; LsGDH; OSJNBb0012J10.18; OSJNBb0038F03.5; OSJNBb0060J21.2; Os02g0650900; Os04g0543900; OsGDH2; OsI_08294; O |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
| Sma3 | mitochondrial matrix | GO:0005759 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | glutamate dehydrogenase (NAD+) activity | GO:0004352 | Molecular Function | 0.0 | - |
| Sma3 | glutamate dehydrogenase [NAD(P)+] activity | GO:0004353 | Molecular Function | 0.0 | - |
| Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
| Sma3 | oxidoreductase activity, acting on the CH-NH2 group of donors, NAD or NADP as acceptor | GO:0016639 | Molecular Function | 0.0 | - |
| Sma3 | cellular amino acid metabolic process | GO:0006520 | Biological Process | 0.0 | - |
| Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
| Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Glutamate/phenylalanine/leucine/valine dehydrogenase | IPR006095 | - | 0.0 | - |
| Sma3 | Glutamate/phenylalanine/leucine/valine dehydrogenase, C-terminal | IPR006096 | - | 0.0 | - |
| Sma3 | Glutamate/phenylalanine/leucine/valine dehydrogenase, dimerisation domain | IPR006097 | - | 0.0 | - |
| Sma3 | Glutamate dehydrogenase | IPR014362 | - | 0.0 | - |
| Sma3 | NAD(P)-binding domain | IPR016040 | - | 0.0 | - |
| Sma3 | EF-Hand 1, calcium-binding site | IPR018247 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G07440.1 | GDH2 glutamate dehydrogenase 2 chr5:2356153-2358012 FORWARD LENGTH=411 | 2.0e-14 | 85% |
| RefSeq | Arabidopsis thaliana | NP_001119184.1 | glutamate dehydrogenase 2 [Arabidopsis thaliana] | 1.0e-14 | 85% |
| RefSeq | Populus trichocarpa | XP_002339508.1 | predicted protein [Populus trichocarpa] | 3.0e-14 | 82% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D9IXC9
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 247 aas, your sequence is shorter than subject: 43 - 411
Fln protein:
Y
Protein Length:
44
Fln nts:
C
Fln Alignment:
GD4IA4404JFEAQ___QKIHHLIGINMDIPAPDMGTNSQTMAWILDEYSK
D9IXC9_______________QKIHDLIGVHIDVPAPDMGTNSQTMAWILDEYSK

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta (sense)