UniGene Name: sp_v3.0_unigene79774
Length: 207 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense) |
---|
>sp_v3.0_unigene79774
G |
Ace file of the UniGene sp_v3.0_unigene79774 (antisense) |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] sp|Q9FLZ9.1|PP405_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g39350 dbj|BAB11009.1| selenium-binding protein-like [Arabidopsis thaliana] gb|AED94423.1| pentatricope | - | - | 1.0e-16 | 64% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 70% |
Sma3 | Pentatricopeptide, putative, expressed | - | - | 6.28e-11 | - |
Source | Gene names |
---|---|
Sma3 | At1g11290; At1g15510; At2g01510; At2g22070; At2g29760; At3g12770; At4g16835; At5g04780; At5g08510; At5g39350; At5g40410; At5g66520; B1032F05.19; B1080A02.28; DYW10; F2I9.13; F8L15.21; FCAALL.441; GSVIVT00000138001; GSVIVT00000293001; GSVIVT00002068001; GS |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | ubiquitin thiolesterase activity | GO:0004221 | Molecular Function | 0.0 | - |
Sma3 | endonuclease activity | GO:0004519 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | methyltransferase activity | GO:0008168 | Molecular Function | 0.0 | - |
Sma3 | deaminase activity | GO:0019239 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | ubiquitin-dependent protein catabolic process | GO:0006511 | Biological Process | 0.0 | - |
Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
Sma3 | purine ribonucleoside monophosphate biosynthetic process | GO:0009168 | Biological Process | 0.0 | - |
Sma3 | mRNA modification | GO:0016556 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Armadillo | IPR000225 | - | 0.0 | - |
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Adenosine/AMP deaminase domain | IPR001365 | - | 0.0 | - |
Sma3 | Peptidase C12, ubiquitin carboxyl-terminal hydrolase 1 | IPR001578 | - | 0.0 | - |
Sma3 | Pentatricopeptide repeat | IPR002885 | - | 0.0 | - |
Sma3 | Domain of unknown function DUF659 | IPR007021 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | IPR011523 | - | 0.0 | - | |
Sma3 | Armadillo-like helical | IPR011989 | - | 0.0 | - |
Sma3 | Tetratricopeptide-like helical | IPR011990 | - | 0.0 | - |
Sma3 | Methyltransferase type 11 | IPR013216 | - | 0.0 | - |
Sma3 | Aldehyde dehydrogenase, conserved site | IPR016160 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - | |
Sma3 | Asp/Glu racemase, active site | IPR018187 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G39350.1 | Tetratricopeptide repeat (TPR)-like superfamily protein chr5:15750929-15752962 FORWARD LENGTH=677 | 1.0e-21 | 64% |
RefSeq | Arabidopsis thaliana | NP_198751.1 | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] | 2.0e-21 | 64% |
RefSeq | Populus trichocarpa | XP_002301939.1 | predicted protein [Populus trichocarpa] | 9.0e-23 | 63% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9P0W0
Fln msg: Distance to subject end: 167 aas, your sequence is shorter than subject: 69 - 370
Fln protein:
V
Protein Length:
70
Fln nts:
G
Fln Alignment:
GD4IA4404IVBE0___HYACMVDLLGRAGCLDEAYKFINKIPVKPNAHVWGALLGACAARSNIELGEHAAERLFEL
A9P0W0_______________HYSCMVDLFGRAGCLDEALNFINQMPVEPNASVWGSLLGACRVHGNIELAERAVEQLIEL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain