UniGene Name: sp_v3.0_unigene79757
Length: 195 nt
UniGene Fasta |
---|
>sp_v3.0_unigene79757
G |
Ace file of the UniGene sp_v3.0_unigene79757 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Beta-xylosidase 3 n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7M267_ARALL | - | - | 2.0e-16 | 63% |
FL-Next | sp=Beta-D-xylosidase 3; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 61% |
Sma3 | Beta-glucosidase, putative | - | - | 4.107e-11 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Beta-glucosidase. | EC:3.2.1.21 | - | 1.144e-15 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Cyanoamino acid metabolism | 00460 | 1.144e-15 | % | |
Sma3 | Starch and sucrose metabolism | 00500 | 1.144e-15 | % | |
Sma3 | Phenylpropanoid biosynthesis | 00940 | 1.144e-15 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 1.144e-15 | % |
Source | Gene names |
---|---|
Sma3 | ARF; At1g78060; At5g09730; At5g10560; At5g10560/F12B17_90; At5g64570; B1011H02.4; BXL7; F12B17_90; F17I14_80; GSVIVT00001462001; GSVIVT00012513001; GSVIVT00015256001; GSVIVT00019692001; GSVIVT00028094001; GSVIVT00033109001; LOC_Os11g18690; LOC_Os11g18730; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | plant-type cell wall | GO:0009505 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
Sma3 | hydrolase activity, hydrolyzing O-glycosyl compounds | GO:0004553 | Molecular Function | 0.0 | - |
Sma3 | xylan 1,4-beta-xylosidase activity | GO:0009044 | Molecular Function | 0.0 | - |
Sma3 | carbohydrate metabolic process | GO:0005975 | Biological Process | 0.0 | - |
Sma3 | xylan catabolic process | GO:0045493 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Parathyroid hormone/parathyroid hormone-related protein | IPR001415 | - | 0.0 | - |
Sma3 | Glycoside hydrolase, family 3, N-terminal | IPR001764 | - | 0.0 | - |
Sma3 | Glycoside hydrolase family 3 C-terminal domain | IPR002772 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G09730.1 | BXL3, ATBXL3, XYL3, ATBX3, BX3 beta-xylosidase 3 chr5:3015319-3018226 REVERSE LENGTH=773 | 2.0e-21 | 61% |
RefSeq | Arabidopsis thaliana | NP_196535.1 | beta-xylosidase 3 [Arabidopsis thaliana] | 3.0e-21 | 61% |
RefSeq | Populus trichocarpa | XP_002303181.1 | predicted protein [Populus trichocarpa] | 2.0e-17 | 52% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q9LXD6
Fln msg: Distance to subject end: 548 aas, your sequence is shorter than subject: 64 - 773
Fln protein:
S
Protein Length:
65
Fln nts:
G
Fln Alignment:
GD4IA4404IAY7R___NVNIFRDPRWGRGQETPGEDPHVASLYATNYVQGLQETEGGDPNS*RWRPAANITRPMTVDNW
Q9LXD6_______________NVNIFRDPRWGRGQETPGEDPTLSSKYAVAYVKGLQETDGGDPNRLKVAACCKHYTAYDIDNW
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain