|
||||||
|
UniGene Name: sp_v3.0_unigene79717
Length: 182 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene79717
G |
|
Ace file of the UniGene sp_v3.0_unigene79717 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | BTH-induced ERF transcriptional factor 1 [Oryza sativa Indica Group] | - | - | 1.0e-13 | 75% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 74% |
| Sma3 | AP2/ERF domain-containing transcription factor | - | - | 7.51301e-40 | - |
| Source | Gene names |
|---|---|
| Sma3 | 8F2.12; AP2DCP; At1g43160; At1g72360; At2g33710; At2g47520; At4g11140; At4g18450; At4g23750; At5g07310; At5g13330; At5g50080; At5g61890; B1011A07.39; B1056G08.120; BIERF1; BIERF4; CEF1; CMe-ERF2; CRF1; CRF2; DREB; DREB14; DcERF2; EREB; EREB1; EREB2; EREBP |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | nucleolus | GO:0005730 | Cellular Component | 0.0 | - |
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | sequence-specific DNA binding transcription factor activity | GO:0003700 | Molecular Function | 0.0 | - |
| Sma3 | phosphatidylinositol phospholipase C activity | GO:0004435 | Molecular Function | 0.0 | - |
| Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
| Sma3 | lipid metabolic process | GO:0006629 | Biological Process | 0.0 | - |
| Sma3 | defense response | GO:0006952 | Biological Process | 0.0 | - |
| Sma3 | GO:0007242 | Biological Process | 0.0 | - | |
| Sma3 | cytokinin mediated signaling pathway | GO:0009736 | Biological Process | 0.0 | - |
| Sma3 | ethylene mediated signaling pathway | GO:0009873 | Biological Process | 0.0 | - |
| Sma3 | response to chitin | GO:0010200 | Biological Process | 0.0 | - |
| Sma3 | transcription factor import into nucleus | GO:0042991 | Biological Process | 0.0 | - |
| Sma3 | leaf development | GO:0048366 | Biological Process | 0.0 | - |
| Sma3 | cotyledon development | GO:0048825 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Ornithine/DAP/Arg decarboxylase | IPR000183 | - | 0.0 | - |
| Sma3 | AP2/ERF domain | IPR001471 | - | 0.0 | - |
| Sma3 | Phospholipase C, phosphatidylinositol-specific, Y domain | IPR001711 | - | 0.0 | - |
| Sma3 | Aminotransferase, class-II, pyridoxal-phosphate binding site | IPR001917 | - | 0.0 | - |
| Sma3 | Enolpyruvate transferase domain | IPR001986 | - | 0.0 | - |
| Sma3 | Ubiquinol cytochrome reductase, transmembrane domain | IPR004192 | - | 0.0 | - |
| Sma3 | IPR004348 | - | 0.0 | - | |
| Sma3 | Rieske iron-sulphur protein, C-terminal | IPR005805 | - | 0.0 | - |
| Sma3 | IPR005806 | - | 0.0 | - | |
| Sma3 | Ubiquinol-cytochrome c reductase, iron-sulphur subunit | IPR006317 | - | 0.0 | - |
| Sma3 | Rieske iron-sulphur protein | IPR014349 | - | 0.0 | - |
| Sma3 | Pathogenesis-related genes transcriptional activator PTI6 | IPR017392 | - | 0.0 | - |
| Sma3 | Rieske [2Fe-2S] iron-sulphur domain | IPR017941 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G43160.1 | RAP2.6 related to AP2 6 chr1:16263989-16264663 FORWARD LENGTH=192 | 8.0e-19 | 70% |
| RefSeq | Arabidopsis thaliana | NP_175008.1 | ethylene-responsive transcription factor RAP2-6 [Arabidopsis thaliana] | 1.0e-18 | 70% |
| RefSeq | Populus trichocarpa | XP_002328620.1 | AP2/ERF domain-containing transcription factor [Populus trichocarpa] | 3.0e-19 | 68% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9P288
Fln msg: Distance to subject end: 263 aas, your sequence is shorter than subject: 60 - 429
Fln protein:
V
Protein Length:
61
Fln nts:
G
Fln Alignment:
GD4IA4404JIUCR___STKSRKYRGVRQRKWGKWAAEIRDPSRGVRVWLGTYETAEAAA
A9P288_______________SSKKRRYRGVRQRPWGKWAAEIRDPKKAARVWLGTFDTAEDAA
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
