UniGene Name: sp_v3.0_unigene79701
Length: 214 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene79701
T |
Ace file of the UniGene sp_v3.0_unigene79701
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Probable protein phosphatase 2C 3 n=4 Tax=BEP clade RepID=P2C03_ORYSJ | - | - | 6.0e-22 | 78% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 95% |
| Sma3 | Protein phosphatase, putative | - | - | 2.383e-11 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Phosphoprotein phosphatase. | EC:3.1.3.16 | - | 6.787e-19 | - |
| Source | Gene names |
|---|---|
| Sma3 | AT1G68410; At1g09160; At1g47380; At1g68410; B1045B05.36; CaMPP; GSVIVT00014800001; GSVIVT00022659001; GSVIVT00030384001; H0818E04.11; LOC_Os01g32964; LOC_Os02g35910; LOC_Os03g18970; LOC_Os03g27780; LOC_Os04g37660; LOC_Os09g28560; MtrDRAFT_AC147963g28v2; O |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | magnesium ion binding | GO:0000287 | Molecular Function | 0.0 | - |
| Sma3 | catalytic activity | GO:0003824 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | phosphoprotein phosphatase activity | GO:0004721 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | manganese ion binding | GO:0030145 | Molecular Function | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Protein phosphatase 2C, manganese/magnesium aspartate binding site | IPR000222 | - | 0.0 | - |
| Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
| Sma3 | Protein phosphatase 2C-like | IPR001932 | - | 0.0 | - |
| Sma3 | Zinc finger, C2H2 | IPR007087 | - | 0.0 | - |
| Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
| Sma3 | IPR010822 | - | 0.0 | - | |
| Sma3 | IPR014045 | - | 0.0 | - | |
| Sma3 | Protein phosphatase 2C | IPR015655 | - | 0.0 | - |
| Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
| Sma3 | IPR017442 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G68410.1 | Protein phosphatase 2C family protein chr1:25650262-25652255 REVERSE LENGTH=436 | 1.0e-25 | 77% |
| RefSeq | Arabidopsis thaliana | NP_177008.1 | putative protein phosphatase 2C 15 [Arabidopsis thaliana] | 2.0e-25 | 77% |
| RefSeq | Populus trichocarpa | XP_002312412.1 | predicted protein [Populus trichocarpa] | 2.0e-27 | 76% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LLF8
Fln msg: Distance to subject end: 116 aas, your sequence is shorter than subject: 71 - 436
Fln protein:
G
Protein Length:
72
Fln nts:
T
Fln Alignment:
GD4IA4404II9Z5___GGRLIIATDGVWDALSSEKAANCCRGLPAELAAKQIVKL*EALRIRGLRDDTTCIVVDLIPPEKSAPLAPV
B8LLF8_______________GGRLIIATDGVWDALSSEKAANCCRGLPAELAAKQIVK--EALRIRGLRDDTTCIVVDLIPPEKSAPPAPV

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta