|
||||||
|
UniGene Name: sp_v3.0_unigene79690
Length: 244 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene79690
C |
|
Ace file of the UniGene sp_v3.0_unigene79690
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | transcription cofactor, putative; K04498 E1A/CREB-binding protein [EC:2.3.1.48] | - | - | 6.0e-14 | 77% |
| FL-Next | sp=Histone acetyltransferase HAC12; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 66% |
| Sma3 | p300/CBP acetyltransferase-related protein | - | - | 1.229e-08 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Histone acetyltransferase. | EC:2.3.1.48 | - | 6.0e-14 | 77% |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Histone acetyltransferase. | EC:2.3.1.48 | - | 4.63e-14 | - |
| Source | Gene names |
|---|---|
| Sma3 | At1g16710; At1g79000; At3g12980; F17F16.8; F17F16_21; GSVIVT00029724001; HAC1; HAC12; HAC1501; HAC1502; HAC5; HAC901; HAC902; Loc_Os02g04490; Loc_Os06g49130; MGH6.20; MGH6_9; OSJNBa0026E05.8; OSJNBa0081C13.32; Os02g0137500; Os06g0704800; OsI_05772; OsJ_05 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | transcription coactivator activity | GO:0003713 | Molecular Function | 0.0 | - |
| Sma3 | histone acetyltransferase activity | GO:0004402 | Molecular Function | 0.0 | - |
| Sma3 | GO:0004406 | Molecular Function | 0.0 | - | |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
| Sma3 | protein acetylation | GO:0006473 | Biological Process | 0.0 | - |
| Sma3 | flower development | GO:0009908 | Biological Process | 0.0 | - |
| Sma3 | chromatin modification | GO:0016568 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Zinc finger, TAZ-type | IPR000197 | - | 0.0 | - |
| Sma3 | Zinc finger, ZZ-type | IPR000433 | - | 0.0 | - |
| Sma3 | Zinc finger, PHD-type | IPR001965 | - | 0.0 | - |
| Sma3 | Zinc finger, C2H2 | IPR007087 | - | 0.0 | - |
| Sma3 | IPR009255 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G16710.1 | HAC12 histone acetyltransferase of the CBP family 12 chr1:5714692-5721782 FORWARD LENGTH=1706 | 1.0e-15 | 66% |
| RefSeq | Arabidopsis thaliana | NP_001185015.1 | histone acetyltransferase HAC12 [Arabidopsis thaliana] | 2.0e-15 | 66% |
| RefSeq | Populus trichocarpa | XP_002330477.1 | histone acetyltransferase [Populus trichocarpa] | 4.0e-18 | 77% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q9FWQ5
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 572 aas, your sequence is shorter than subject: 81 - 1706
Fln protein:
Q
Protein Length:
82
Fln nts:
C
Fln Alignment:
GD4IA4404H35D6___GHADYTCPNCCIVEIERGERRPLHQTAILGAKDLPRTSLSDHIEQ
Q9FWQ5_______________GQAEYTCPYCYVIDVEQNERKPLLQSAVLGAKDLPRTILSDHIEQ
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
