UniGene Name: sp_v3.0_unigene79636
Length: 228 nt
UniGene Fasta |
---|
>sp_v3.0_unigene79636
G |
Ace file of the UniGene sp_v3.0_unigene79636 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Cytochrome P450, putative n=1 Tax=Ricinus communis RepID=B9SN45_RICCO | - | - | 1.0e-13 | 57% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 52% |
Sma3 | Cytochrome P450 probable 6-deoxoteasterone to 3-dehydro 6-deoxoteasterone or teasterone to 3-dehydro teasterone | - | - | 1.42e-08 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | EC:1.14.-.- | - | 8.093e-07 | - |
Source | Gene names |
---|---|
Sma3 | AP22.10; At3g13730; At4g36380; C7A10.980; CYP720B2; CYP90C1; CYP90D; CYP90D2; CYP90D5; CYP90D6; D2; F23E13.220; GSVIVT00034159001; GSVIVT00036865001; LOC_Os01g10040; Os01g0197100; OsI_00765; OsI_18805; OsJ_00739; P0419B01.11; P0708D12.2; POPTRDRAFT_678468 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | endoplasmic reticulum membrane | GO:0005789 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | monooxygenase activity | GO:0004497 | Molecular Function | 0.0 | - |
Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
Sma3 | oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NADH or NADPH as one donor, and incorporation of one atom of oxygen | GO:0016709 | Molecular Function | 0.0 | - |
Sma3 | heme binding | GO:0020037 | Molecular Function | 0.0 | - |
Sma3 | leaf morphogenesis | GO:0009965 | Biological Process | 0.0 | - |
Sma3 | brassinosteroid homeostasis | GO:0010268 | Biological Process | 0.0 | - |
Sma3 | brassinosteroid biosynthetic process | GO:0016132 | Biological Process | 0.0 | - |
Sma3 | monopolar cell growth | GO:0042814 | Biological Process | 0.0 | - |
Sma3 | leaf development | GO:0048366 | Biological Process | 0.0 | - |
Sma3 | petal development | GO:0048441 | Biological Process | 0.0 | - |
Sma3 | stamen development | GO:0048443 | Biological Process | 0.0 | - |
Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Cytochrome P450 | IPR001128 | - | 0.0 | - |
Sma3 | Cytochrome P450, E-class, group I | IPR002401 | - | 0.0 | - |
Sma3 | Cytochrome P450, E-class, group IV | IPR002403 | - | 0.0 | - |
Sma3 | Sugar transporter, conserved site | IPR005829 | - | 0.0 | - |
Sma3 | Cytochrome P450, conserved site | IPR017972 | - | 0.0 | - |
Sma3 | IPR017973 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G13730.1 | CYP90D1 cytochrome P450, family 90, subfamily D, polypeptide 1 chr3:4498330-4500836 REVERSE LENGTH=491 | 2.0e-15 | 64% |
RefSeq | Arabidopsis thaliana | NP_566462.1 | 3-epi-6-deoxocathasterone 23-monooxygenase [Arabidopsis thaliana] | 3.0e-15 | 64% |
RefSeq | Populus trichocarpa | XP_002329023.1 | cytochrome P450 probable 6-deoxoteasterone to 3-dehydro 6-deoxoteasterone or teasterone to 3-dehydro teasterone [Populus trichocarpa] | 7.0e-18 | 66% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: C0PR04
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 130 aas, your sequence is shorter than subject: 76 - 486
Fln protein:
D
Protein Length:
77
Fln nts:
G
Fln Alignment:
GD4IA4404ISD32___SLAVKFLTDCPVALQQLQAENMXXXXXXXXXXXXX-TWNDYTSLPFTQNVITETLRMGN
C0PR04_______________SFSIKFLTDCPKAYQELKAEHEDLLRRKGNLRNEKLTWDDYQSMKFTQCVINETLRLGN
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain