|
||||||
|
UniGene Name: sp_v3.0_unigene79622
Length: 212 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene79622
C |
|
Ace file of the UniGene sp_v3.0_unigene79622
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Unassigned protein | - | - | 0.0 | - |
| FL-Next | tr=Putative uncharacterized protein; Vitis vinifera (Grape). | - | - | 0.0 | 77% |
| Sma3 | HAD-superfamily hydrolase, subfamily IA, variant 3 containing protein, expressed | - | - | 4.296e-08 | - |
| Source | Gene names |
|---|---|
| Sma3 | At1g56500; CHLREDRAFT_188073; GSVIVT00022589001; LOC_Os03g19760; Os03g0311300; OsI_07299; OsJ_10596; PHYPADRAFT_128572; POPTRDRAFT_1096018; RCOM_1435490; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | chloroplast stroma | GO:0009570 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | antioxidant activity | GO:0016209 | Molecular Function | 0.0 | - |
| Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
| Sma3 | hydrolase activity | GO:0016787 | Molecular Function | 0.0 | - |
| Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
| Sma3 | cell redox homeostasis | GO:0045454 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | LDLR class B repeat | IPR000033 | - | 0.0 | - |
| Sma3 | Alkyl hydroperoxide reductase subunit C/ Thiol specific antioxidant | IPR000866 | - | 0.0 | - |
| Sma3 | NHL repeat | IPR001258 | - | 0.0 | - |
| Sma3 | Haloacid dehalogenase/epoxide hydrolase | IPR005833 | - | 0.0 | - |
| Sma3 | Haloacid dehalogenase-like hydrolase | IPR005834 | - | 0.0 | - |
| Sma3 | Twin-arginine translocation pathway, signal sequence | IPR006311 | - | 0.0 | - |
| Sma3 | HAD-superfamily hydrolase, subfamily IA, variant 3 | IPR006402 | - | 0.0 | - |
| Sma3 | Six-bladed beta-propeller, TolB-like | IPR011042 | - | 0.0 | - |
| Sma3 | IPR012335 | - | 0.0 | - | |
| Sma3 | NHL repeat, subgroup | IPR013017 | - | 0.0 | - |
| Sma3 | Redoxin | IPR013740 | - | 0.0 | - |
| Sma3 | IPR017936 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G56500.1 | haloacid dehalogenase-like hydrolase family protein chr1:21159775-21167092 FORWARD LENGTH=1055 | 1.0e-30 | 71% |
| RefSeq | Arabidopsis thaliana | NP_564718.2 | haloacid dehalogenase-like hydrolase domain-containing protein [Arabidopsis thaliana] | 2.0e-30 | 71% |
| RefSeq | Populus trichocarpa | XP_002319481.1 | predicted protein [Populus trichocarpa] | 1.0e-25 | 69% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: tr_plants
Fln subject: F6I4T4
Fln msg: Distance to subject end: 330 aas, your sequence is shorter than subject: 70 - 1078
Fln protein:
E
Protein Length:
71
Fln nts:
C
Fln Alignment:
GD4IA4404JNKDO___ETVQTLAGNGEKGSDYKGGRKGMAQVLNSPWDVCVDFSSETVYIAMAGQHQIWQHDIVDGVTRAFSGDGY
F6I4T4_______________ETVQTLAGNGTKGSDYQGGGKGATQLLNSPWDVCFEPINEIVYIAMAGQHQIWEHNTLDGVTRAFSGDGY
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
