SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene79596

Length: 238 nt

This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense

UniGene Fasta (sense)

>sp_v3.0_unigene79596
TCTCTGTCTGCATTGGGACTTGTGATCATGAGCCTAGTTGATATTGCTAATGGAAAGCAGCGTCATGTGCCATACCGTGATTCCAAGCTCACGTTTCTCTTGCAGGATTCCCTTGGTGGAAACGCAAAAACTACAGTCATTGCAAATATCAGCCCTTCCAGCTGCTGTGCAATAGAAACATTGAGTACACTAAAATTTGCGCAACGGGCAAAGTTCATACAGAATACTGTTGTTATTA

Ace file of the UniGene sp_v3.0_unigene79596 (antisense)

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Kinesin, motor region [Medicago truncatula]	-	-	2.0e-29	79%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	40%
Sma3	Kinesin-like protein	-	-	3.059e-20	-

Source	Gene names
Sma3	AT4g14150; ATK4; At2g28620; At2g36200; At2g37420; At2g47500; At3g10310; At3g23670; At3g44050; At3g45850; At3g50240; At3g63480; At3g63480/MAA21_110; At4g14150; At5g27000; At5g47820; B1066G12.23; CHLREDRAFT_114085; CHLREDRAFT_13743; CHLREDRAFT_137882; CHLRE

Source	GOs	Term	Type	Identity
Sma3	cytoplasm	GO:0005737	Cellular Component	-
Sma3	microtubule	GO:0005874	Cellular Component	-
Sma3	microtubule associated complex	GO:0005875	Cellular Component	-
Sma3	plasma membrane	GO:0005886	Cellular Component	-
Sma3	phragmoplast	GO:0009524	Cellular Component	-
Sma3	sequence-specific DNA binding transcription factor activity	GO:0003700	Molecular Function	-
Sma3	microtubule motor activity	GO:0003777	Molecular Function	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	microtubule binding	GO:0008017	Molecular Function	-
Sma3	plus-end-directed microtubule motor activity	GO:0008574	Molecular Function	-
Sma3	ATPase activity	GO:0016887	Molecular Function	-
Sma3	sequence-specific DNA binding	GO:0043565	Molecular Function	-
Sma3	cytokinesis	GO:0000910	Biological Process	-
Sma3	phragmoplast assembly	GO:0000914	Biological Process	-
Sma3	regulation of transcription, DNA-dependent	GO:0006355	Biological Process	-
Sma3	defense response	GO:0006952	Biological Process	-
Sma3	microtubule-based movement	GO:0007018	Biological Process	-
Sma3	response to biotic stimulus	GO:0009607	Biological Process	-
Sma3	cellulose microfibril organization	GO:0010215	Biological Process	-
Sma3	actin filament polymerization	GO:0030041	Biological Process	-
Sma3	microgametogenesis	GO:0055046	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	IQ motif, EF-hand binding site	IPR000048	-	-
Sma3	ATPase, F1/V1/A1 complex, alpha/beta subunit, nucleotide-binding domain	IPR000194	-	-
Sma3	Bet v I domain	IPR000916	-	-
Sma3	Calponin homology domain	IPR001715	-	-
Sma3	Kinesin, motor domain	IPR001752	-	-
Sma3	Basic-leucine zipper domain	IPR004827	-	-
Sma3	Aspartate/ornithine carbamoyltransferase	IPR006130	-	-
Sma3	ARP23 complex 20kDa subunit	IPR008384	-	-
Sma3	Kinesin-related conserved domain	IPR010544	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT3G44050.1	P-loop containing nucleoside triphosphate hydrolases superfamily protein chr3:15818738-15824792 FORWARD LENGTH=1263	8.0e-34	75%
RefSeq	Arabidopsis thaliana	NP_189991.2	kinesin motor protein-like protein [Arabidopsis thaliana]	1.0e-33	75%
RefSeq	Populus trichocarpa	XP_002328088.1	predicted protein [Populus trichocarpa]	1.0e-35	78%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: D5ACB2

Fln msg: Distance to subject end: 277 aas, your sequence is shorter than subject: 79 - 509

Fln protein: SLSALGLVIMSLVDIANGKQRHVPYRDSKLTFLLQDSLGGNAKTTVIANISPSSCCAIETLSTLKFAQRAKFIQNTVVI

Protein Length: 80

Fln nts: TCTCTGTCTGCATTGGGACTTGTGATCATGAGCCTAGTTGATATTGCTAATGGAAAGCAGCGTCATGTGCCATACCGTGATTCCAAGCTCACGTTTCTCTTGCAGGATTCCCTTGGTGGAAACGCAAAAACTACAGTCATTGCAAATATCAGCCCTTCCAGCTGCTGTGCAATAGAAACATTGAGTACACTAAAATTTGCGCAACGGGCAAAGTTCATACAGAATACTGTTGTTATTA

Fln Alignment:

GD4IA4404JPLTH___LVIMSLVDIANGKQRHVPYRDSKLTFLLQDSLGGNAKTTVIANISPSSCCAIETLSTLKFAQRAK
D5ACB2_______________LALKECIRALDNDQIHIPFRGSKLTEVLRDSFVGNSRTVMISCVSPNSGSCEHTLNTLRYADRVK

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain