UniGene Name: sp_v3.0_unigene79596
Length: 238 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene79596
T |
Ace file of the UniGene sp_v3.0_unigene79596 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Kinesin, motor region [Medicago truncatula] | - | - | 2.0e-29 | 79% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 40% |
| Sma3 | Kinesin-like protein | - | - | 3.059e-20 | - |
| Source | Gene names |
|---|---|
| Sma3 | AT4g14150; ATK4; At2g28620; At2g36200; At2g37420; At2g47500; At3g10310; At3g23670; At3g44050; At3g45850; At3g50240; At3g63480; At3g63480/MAA21_110; At4g14150; At5g27000; At5g47820; B1066G12.23; CHLREDRAFT_114085; CHLREDRAFT_13743; CHLREDRAFT_137882; CHLRE |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | microtubule | GO:0005874 | Cellular Component | 0.0 | - |
| Sma3 | microtubule associated complex | GO:0005875 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | phragmoplast | GO:0009524 | Cellular Component | 0.0 | - |
| Sma3 | sequence-specific DNA binding transcription factor activity | GO:0003700 | Molecular Function | 0.0 | - |
| Sma3 | microtubule motor activity | GO:0003777 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | microtubule binding | GO:0008017 | Molecular Function | 0.0 | - |
| Sma3 | plus-end-directed microtubule motor activity | GO:0008574 | Molecular Function | 0.0 | - |
| Sma3 | ATPase activity | GO:0016887 | Molecular Function | 0.0 | - |
| Sma3 | sequence-specific DNA binding | GO:0043565 | Molecular Function | 0.0 | - |
| Sma3 | cytokinesis | GO:0000910 | Biological Process | 0.0 | - |
| Sma3 | phragmoplast assembly | GO:0000914 | Biological Process | 0.0 | - |
| Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
| Sma3 | defense response | GO:0006952 | Biological Process | 0.0 | - |
| Sma3 | microtubule-based movement | GO:0007018 | Biological Process | 0.0 | - |
| Sma3 | response to biotic stimulus | GO:0009607 | Biological Process | 0.0 | - |
| Sma3 | cellulose microfibril organization | GO:0010215 | Biological Process | 0.0 | - |
| Sma3 | actin filament polymerization | GO:0030041 | Biological Process | 0.0 | - |
| Sma3 | microgametogenesis | GO:0055046 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | IQ motif, EF-hand binding site | IPR000048 | - | 0.0 | - |
| Sma3 | ATPase, F1/V1/A1 complex, alpha/beta subunit, nucleotide-binding domain | IPR000194 | - | 0.0 | - |
| Sma3 | Bet v I domain | IPR000916 | - | 0.0 | - |
| Sma3 | Calponin homology domain | IPR001715 | - | 0.0 | - |
| Sma3 | Kinesin, motor domain | IPR001752 | - | 0.0 | - |
| Sma3 | Basic-leucine zipper domain | IPR004827 | - | 0.0 | - |
| Sma3 | Aspartate/ornithine carbamoyltransferase | IPR006130 | - | 0.0 | - |
| Sma3 | ARP23 complex 20kDa subunit | IPR008384 | - | 0.0 | - |
| Sma3 | Kinesin-related conserved domain | IPR010544 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G44050.1 | P-loop containing nucleoside triphosphate hydrolases superfamily protein chr3:15818738-15824792 FORWARD LENGTH=1263 | 8.0e-34 | 75% |
| RefSeq | Arabidopsis thaliana | NP_189991.2 | kinesin motor protein-like protein [Arabidopsis thaliana] | 1.0e-33 | 75% |
| RefSeq | Populus trichocarpa | XP_002328088.1 | predicted protein [Populus trichocarpa] | 1.0e-35 | 78% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5ACB2
Fln msg: Distance to subject end: 277 aas, your sequence is shorter than subject: 79 - 509
Fln protein:
S
Protein Length:
80
Fln nts:
T
Fln Alignment:
GD4IA4404JPLTH___LVIMSLVDIANGKQRHVPYRDSKLTFLLQDSLGGNAKTTVIANISPSSCCAIETLSTLKFAQRAK
D5ACB2_______________LALKECIRALDNDQIHIPFRGSKLTEVLRDSFVGNSRTVMISCVSPNSGSCEHTLNTLRYADRVK

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta (sense)