|
||||||
|
UniGene Name: sp_v3.0_unigene79538
Length: 210 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene79538
A |
|
Ace file of the UniGene sp_v3.0_unigene79538 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Unassigned protein | - | - | 0.0 | - |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 68% |
| Sma3 | Putative pentatricopeptide | - | - | 1.465e-07 | - |
| Source | Gene names |
|---|---|
| Sma3 | At1g06140; At1g10330; At1g15510; At1g17630; At1g20230; At2g22070; At3g46790; At4g02750; At4g16835; At4g21300; At5g06540; At5g08510; At5g48910; At5g59200; At5g66520; B1032F05.19; CRR2; DYW10; F14N23.21; F15M7.7; F1L3.33; F8L15.21; FCAALL.441; GSVIVT0000013 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
| Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | diacylglycerol kinase activity | GO:0004143 | Molecular Function | 0.0 | - |
| Sma3 | ubiquitin thiolesterase activity | GO:0004221 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | deaminase activity | GO:0019239 | Molecular Function | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | ubiquitin-dependent protein catabolic process | GO:0006511 | Biological Process | 0.0 | - |
| Sma3 | activation of protein kinase C activity by G-protein coupled receptor protein signaling pathway | GO:0007205 | Biological Process | 0.0 | - |
| Sma3 | purine ribonucleoside monophosphate biosynthetic process | GO:0009168 | Biological Process | 0.0 | - |
| Sma3 | chloroplast RNA processing | GO:0031425 | Biological Process | 0.0 | - |
| Sma3 | polycistronic mRNA processing | GO:0031426 | Biological Process | 0.0 | - |
| Sma3 | cell redox homeostasis | GO:0045454 | Biological Process | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G02750.1 | Tetratricopeptide repeat (TPR)-like superfamily protein chr4:1221116-1223461 REVERSE LENGTH=781 | 1.0e-23 | 57% |
| RefSeq | Arabidopsis thaliana | NP_192184.1 | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] | 2.0e-23 | 57% |
| RefSeq | Populus trichocarpa | XP_002320193.1 | predicted protein [Populus trichocarpa] | 2.0e-25 | 65% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9P0W0
Fln msg: Distance to subject end: 174 aas, your sequence is shorter than subject: 69 - 370
Fln protein:
D
Protein Length:
70
Fln nts:
A
Fln Alignment:
GD4IA4404JWLSK___DYGIMPTVEHYACMVDLLGRSGCLSEAQHFINKMPLEPDACVLGALLGACRMHGNIELAERVAERLFVL
A9P0W0_______________DHGISPKAEHYSCMVDLFGRAGCLDEALNFINQMPVEPNASVWGSLLGACRVHGNIELAERAVEQLIEL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
