UniGene Name: sp_v3.0_unigene79531
Length: 204 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene79531
A |
Ace file of the UniGene sp_v3.0_unigene79531
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Class III peroxidase 88 n=3 Tax=Oryza sativa RepID=Q5Z7K0_ORYSJ | - | - | 1.0e-16 | 64% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 80% |
| Sma3 | Peroxidase | - | - | 0.0 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Peroxidase. | EC:1.11.1.7 | - | 0.0 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Phenylalanine metabolism | 00360 | 0.0 | % | |
| Sma3 | Methane metabolism | 00680 | 0.0 | % | |
| Sma3 | Phenylpropanoid biosynthesis | 00940 | 0.0 | % | |
| Sma3 | Biosynthesis of phenylpropanoids | 01061 | 0.0 | % | |
| Sma3 | Metabolic pathways | 01100 | 0.0 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 0.0 | % |
| Source | Gene names |
|---|---|
| Sma3 | AT3G32980; AoPOX1; At1g49570; At2g18140; At3g32980; At5g05340; At5g06720; F14J22.19; F8D23.8; FBP5; GSVIVT00015157001; GSVIVT00015158001; GSVIVT00015159001; GSVIVT00015160001; GSVIVT00018769001; GSVIVT00018771001; GSVIVT00023967001; GSVIVT00023970001; GSV |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | extracellular region | GO:0005576 | Cellular Component | 0.0 | - |
| Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
| Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
| Sma3 | peroxidase activity | GO:0004601 | Molecular Function | 0.0 | - |
| Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
| Sma3 | calcium ion binding | GO:0005509 | Molecular Function | 0.0 | - |
| Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
| Sma3 | heme binding | GO:0020037 | Molecular Function | 0.0 | - |
| Sma3 | response to oxidative stress | GO:0006979 | Biological Process | 0.0 | - |
| Sma3 | hydrogen peroxide catabolic process | GO:0042744 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | GPCR, rhodopsin-like, 7TM | IPR000276 | - | 0.0 | - |
| Sma3 | Plant peroxidase | IPR000823 | - | 0.0 | - |
| Sma3 | Haem peroxidase, plant/fungal/bacterial | IPR002016 | - | 0.0 | - |
| Sma3 | Thymidylate kinase, conserved site | IPR018095 | - | 0.0 | - |
| Sma3 | Peroxidases heam-ligand binding site | IPR019793 | - | 0.0 | - |
| Sma3 | Peroxidase, active site | IPR019794 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G06720.1 | ATPA2, PA2 peroxidase 2 chr5:2077567-2078857 REVERSE LENGTH=335 | 4.0e-19 | 58% |
| RefSeq | Arabidopsis thaliana | NP_196290.1 | peroxidase 53 [Arabidopsis thaliana] | 5.0e-19 | 58% |
| RefSeq | Populus trichocarpa | XP_002320417.1 | predicted protein [Populus trichocarpa] | 1.0e-21 | 63% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NN21
Fln msg: Distance to subject end: 150 aas, your sequence is shorter than subject: 67 - 324
Fln protein:
R
Protein Length:
68
Fln nts:
A
Fln Alignment:
GD4IA4404IZ27Q___CNATVSCADILAIAAQQSVSLSGGPSWTVQLGRRDSTTASSTLPNTALPGPTDSLSTIITKF
A9NN21_______________CSATVSCADILAIAAERSVSMSGGPSWNVQLGRRDSTTANATLVKTAFASPTDSLSTIITKF

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta