UniGene Name: sp_v3.0_unigene79511
Length: 187 nt
![]() |
---|
>sp_v3.0_unigene79511
T |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | AP2/EREBP transcription factor [Brassica napus] gb|ABD72476.1| AP2/EREBP transcriptional factor WRI1 [Brassica napus] | - | - | 2.0e-26 | 86% |
FL-Next | tr=AINTEGUMENTA-like protein; Pinus thunbergii (Japanese black pine) (Pinus thunbergiana). | - | - | 0.0 | 73% |
Sma3 | AP2 domain-containing transcription factor | - | - | 0.0 | - |
Source | Gene names |
---|---|
Sma3 | 117M18_31; 57h21.37; AIL1; AIL3; AIL4; AIL5; AIL6; AIL7; ANT; ANTL1A; ANTL1B; AP2D10; AP2D14; AP2D16; AP2D4; AP2D8; AP2LP; ASML1; At1g16060; At1g51190; At1g72570; At1g79700; At2g41710; At3g20840; At3g54320; At4g37750; At5g10510; At5g17430; At5g57390; At5g |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | sequence-specific DNA binding transcription factor activity | GO:0003700 | Molecular Function | 0.0 | - |
Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
Sma3 | response to stress | GO:0006950 | Biological Process | 0.0 | - |
Sma3 | multicellular organismal development | GO:0007275 | Biological Process | 0.0 | - |
Sma3 | pattern specification process | GO:0007389 | Biological Process | 0.0 | - |
Sma3 | auxin mediated signaling pathway | GO:0009734 | Biological Process | 0.0 | - |
Sma3 | seed germination | GO:0009845 | Biological Process | 0.0 | - |
Sma3 | ethylene mediated signaling pathway | GO:0009873 | Biological Process | 0.0 | - |
Sma3 | flower development | GO:0009908 | Biological Process | 0.0 | - |
Sma3 | stem cell maintenance | GO:0019827 | Biological Process | 0.0 | - |
Sma3 | cell differentiation | GO:0030154 | Biological Process | 0.0 | - |
Sma3 | regulation of cell proliferation | GO:0042127 | Biological Process | 0.0 | - |
Sma3 | root development | GO:0048364 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | IPR000173 | - | 0.0 | - | |
Sma3 | AP2/ERF domain | IPR001471 | - | 0.0 | - |
Sma3 | Zein-binding domain | IPR007656 | - | 0.0 | - |
Sma3 | DNA topoisomerase, type IIA, conserved site | IPR018522 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G54320.1 | WRI1, WRI, ASML1, ATWRI1 Integrase-type DNA-binding superfamily protein chr3:20114809-20118599 FORWARD LENGTH=438 | 8.0e-34 | 85% |
RefSeq | Arabidopsis thaliana | NP_001030857.1 | ethylene-responsive transcription factor WRI1 [Arabidopsis thaliana] | 1.0e-33 | 85% |
RefSeq | Populus trichocarpa | XP_002325111.1 | AP2 domain-containing transcription factor [Populus trichocarpa] | 2.0e-34 | 88% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: Q76H96
Fln msg: Distance to subject end: 368 aas, your sequence is shorter than subject: 61 - 606
Fln protein:
T
Protein Length:
62
Fln nts:
T
Fln Alignment:
GD4IA4404IQL8S___TRHRWTGRYEAHLWDKNCWNQGQNKKGRQVYLGAYDDEEAAAHTYDLAALKYWGTETILNF
Q76H96_______________TRHRWTGRYEAHLWDNSCRKEGQTRKGRQVYLGGYDKEEKAARAYDLAALKYWGPSTHINF
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain