UniGene Name: sp_v3.0_unigene79400
Length: 168 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene79400
T |
Ace file of the UniGene sp_v3.0_unigene79400 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Putative pleiotropic drug resistance protein 7 n=6 Tax=Poaceae RepID=PDR7_ORYSJ | - | - | 2.0e-19 | 69% |
| FL-Next | sp=Putative pleiotropic drug resistance protein 7; Oryza sativa subsp. japonica (Rice). | - | - | 0.0 | 69% |
| Sma3 | ATP-binding cassette transporter, putative | - | - | 2.8026e-45 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Phosphonate-transporting ATPase. | EC:3.6.3.28 | - | 2.267e-35 | - |
| Sma3 | Polyamine-transporting ATPase. | EC:3.6.3.31 | - | 7.935e-06 | - |
| Sma3 | Heme-transporting ATPase. | EC:3.6.3.41 | - | 1.266e-08 | - |
| Source | Gene names |
|---|---|
| Sma3 | ABC; ABC1; At1g15210; At1g15520; At1g59870; At1g66950; At2g26910; At2g36380; At3g16340; B1090H08.39; F12C20.5; F1O11.1; F1O19.3; F23H11.19; F9L1.15; GSVIVT00016813001; GSVIVT00016819001; GSVIVT00021655001; GSVIVT00022041001; GSVIVT00022062001; GSVIVT00022 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | cadmium ion transmembrane transporter activity | GO:0015086 | Molecular Function | 0.0 | - |
| Sma3 | ATPase activity | GO:0016887 | Molecular Function | 0.0 | - |
| Sma3 | transport | GO:0006810 | Biological Process | 0.0 | - |
| Sma3 | defense response | GO:0006952 | Biological Process | 0.0 | - |
| Sma3 | response to biotic stimulus | GO:0009607 | Biological Process | 0.0 | - |
| Sma3 | systemic acquired resistance | GO:0009627 | Biological Process | 0.0 | - |
| Sma3 | response to ethylene stimulus | GO:0009723 | Biological Process | 0.0 | - |
| Sma3 | response to salicylic acid stimulus | GO:0009751 | Biological Process | 0.0 | - |
| Sma3 | response to jasmonic acid stimulus | GO:0009753 | Biological Process | 0.0 | - |
| Sma3 | defense response to fungus, incompatible interaction | GO:0009817 | Biological Process | 0.0 | - |
| Sma3 | response to ozone | GO:0010193 | Biological Process | 0.0 | - |
| Sma3 | cadmium ion transport | GO:0015691 | Biological Process | 0.0 | - |
| Sma3 | lead ion transport | GO:0015692 | Biological Process | 0.0 | - |
| Sma3 | negative regulation of defense response | GO:0031348 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Ribosomal protein L11 | IPR000911 | - | 0.0 | - |
| Sma3 | DNA methylase, N-6 adenine-specific, conserved site | IPR002052 | - | 0.0 | - |
| Sma3 | ABC transporter-like | IPR003439 | - | 0.0 | - |
| Sma3 | AAA+ ATPase domain | IPR003593 | - | 0.0 | - |
| Sma3 | Pleiotropic drug resistance protein PDR | IPR005285 | - | 0.0 | - |
| Sma3 | Phosphopantetheine attachment site | IPR006162 | - | 0.0 | - |
| Sma3 | ABC-2 type transporter | IPR013525 | - | 0.0 | - |
| Sma3 | Plant PDR ABC transporter associated | IPR013581 | - | 0.0 | - |
| Sma3 | ABC transporter, conserved site | IPR017871 | - | 0.0 | - |
| Sma3 | Peptidase S26A, signal peptidase I, serine active site | IPR019756 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G15520.1 | PDR12, ATPDR12, ABCG40, ATABCG40 pleiotropic drug resistance 12 chr1:5331993-5338175 REVERSE LENGTH=1423 | 1.0e-21 | 69% |
| RefSeq | Arabidopsis thaliana | NP_173005.1 | ABC transporter G family member 40 [Arabidopsis thaliana] | 2.0e-21 | 69% |
| RefSeq | Populus trichocarpa | XP_002303856.1 | predicted protein [Populus trichocarpa] | 1.0e-22 | 69% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q8GU88
Fln msg: Distance to subject end: 812 aas, your sequence is shorter than subject: 55 - 1444
Fln protein:
S
Protein Length:
56
Fln nts:
T
Fln Alignment:
GD4IA4404JIRCG___SMMIARLPVFYKQRDLLFYPSWAYSLPTWIVKIPFSLVEAVIWVCVTYYVIGFAP
Q8GU88_______________AMSIAKLPIFYKQRDLLFYPSWAYALPTWVLKIPISFLECAVWICMTYYVMGFDP

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta (sense)