UniGene Name: sp_v3.0_unigene79310
Length: 213 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene79310
G |
Ace file of the UniGene sp_v3.0_unigene79310
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | anthocyanidin reductase [Ginkgo biloba] | - | - | 4.0e-12 | 63% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 84% |
| Sma3 | Cinnamoyl CoA reductase | - | - | 7.33e-09 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Dihydrokaempferol 4-reductase. | EC:1.1.1.219 | - | 3.009e-15 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Flavonoid biosynthesis | 00941 | 3.009e-15 | % | |
| Sma3 | Biosynthesis of phenylpropanoids | 01061 | 3.009e-15 | % | |
| Sma3 | Metabolic pathways | 01100 | 3.009e-15 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 3.009e-15 | % | |
| Sma3 | Cinnamoyl-CoA reductase. | EC:1.2.1.44 | - | 6.116e-11 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Phenylpropanoid biosynthesis | 00940 | 6.116e-11 | % | |
| Sma3 | Biosynthesis of phenylpropanoids | 01061 | 6.116e-11 | % | |
| Sma3 | Metabolic pathways | 01100 | 6.116e-11 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 6.116e-11 | % |
| Source | Gene names |
|---|---|
| Sma3 | AN6; AT1G15950; ApDFR; At1g15950; At1g80820; CAD1-1; CAD1-7; CCR; CCR1; CCR2; CCRL1; CCRL3; DFR; DFR2; DFRA; Dfr1; F23A5.17; GSVIVT00000921001; GSVIVT00001375001; GSVIVT00002404001; GSVIVT00002448001; GSVIVT00008924001; GSVIVT00008925001; GSVIVT0000892900 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
| Sma3 | catalytic activity | GO:0003824 | Molecular Function | 0.0 | - |
| Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
| Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | transcription repressor activity | GO:0016564 | Molecular Function | 0.0 | - |
| Sma3 | cinnamoyl-CoA reductase activity | GO:0016621 | Molecular Function | 0.0 | - |
| Sma3 | dihydrokaempferol 4-reductase activity | GO:0045552 | Molecular Function | 0.0 | - |
| Sma3 | coenzyme binding | GO:0050662 | Molecular Function | 0.0 | - |
| Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
| Sma3 | regulation of nitrogen utilization | GO:0006808 | Biological Process | 0.0 | - |
| Sma3 | flavonoid biosynthetic process | GO:0009813 | Biological Process | 0.0 | - |
| Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
| Sma3 | cellular metabolic process | GO:0044237 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Reverse transcriptase | IPR000477 | - | 0.0 | - |
| Sma3 | NAD-dependent epimerase/dehydratase | IPR001509 | - | 0.0 | - |
| Sma3 | Integrase, catalytic core | IPR001584 | - | 0.0 | - |
| Sma3 | Zinc finger, CCHC-type | IPR001878 | - | 0.0 | - |
| Sma3 | 3-beta hydroxysteroid dehydrogenase/isomerase | IPR002225 | - | 0.0 | - |
| Sma3 | NmrA-like | IPR008030 | - | 0.0 | - |
| Sma3 | IPR013084 | - | 0.0 | - | |
| Sma3 | Reverse transcriptase, RNA-dependent DNA polymerase | IPR013103 | - | 0.0 | - |
| Sma3 | NAD(P)-binding domain | IPR016040 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G19440.1 | NAD(P)-binding Rossmann-fold superfamily protein chr5:6556493-6558123 FORWARD LENGTH=326 | 2.0e-15 | 61% |
| RefSeq | Arabidopsis thaliana | NP_197445.1 | Rossmann-fold NAD(P)-binding domain-containing protein [Arabidopsis thaliana] | 2.0e-15 | 61% |
| RefSeq | Populus trichocarpa | XP_002314050.1 | cinnamoyl CoA reductase-like protein [Populus trichocarpa] | 1.0e-16 | 62% |
Full-Lengther Next Prediction |
|---|
Fln status: Putative N-terminus
Fln database: coniferopsida.fasta
Fln subject: A9P2C7
Fln msg: Distance to subject end: 277 aas, atg_distance in limit (1-15): atg_distance = 3, W2: There is no M at the beginning, your sequence is shorter than subject: 71 - 350
Fln protein:
G
Protein Length:
72
Fln nts:
G
Fln Alignment:
GD4IA4404JTC2N___KVNIDPLLPQVENRSHVYCVTGGGGYIGSWLVKTLLENGHTVHATLRDPENPSKNTCLLSLPGAQERLRL
A9P2C7_______________KMNIDPLFTQQENRRQVYCVTGGGGYIGSWLVKTLLENGYTVHATLRDPGNTSKNSFLLSLPGAQERLRL
SSRs (tot: 1) |
|---|
| Start position | End position | Sequence | Length |
|---|---|---|---|
| 66 | 78 | AGG AGG AGG AGG A | 13 |

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta