UniGene Name: sp_v3.0_unigene79291
Length: 191 nt
![]() |
---|
>sp_v3.0_unigene79291
G |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Lipoxygenase n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7L1P1_ARALL | - | - | 2.0e-10 | 78% |
FL-Next | sp=Lipoxygenase; Taxus wallichiana var. chinensis (Chinese yew) (Taxus chinensis). | - | - | 0.0 | 84% |
Sma3 | Lipoxygenase | - | - | 1.427e-35 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Lipoxygenase. | EC:1.13.11.12 | - | 1.70099e-40 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Linoleic acid metabolism | 00591 | 1.70099e-40 | % | |
Sma3 | alpha-Linolenic acid metabolism | 00592 | 1.70099e-40 | % | |
Sma3 | Biosynthesis of plant hormones | 01070 | 1.70099e-40 | % | |
Sma3 | Metabolic pathways | 01100 | 1.70099e-40 | % |
Source | Gene names |
---|---|
Sma3 | GSVIVT00019960001; LOC_Os03g49350; LOC_Os03g49380; LOX; LOX1; LOX1.1; LOX4; LOX5; LOXA; LoxC; OSJNBb0017F17.2; Os03g0700400; Os03g0700700; OsI_13165; OsJ_12238; POPTRDRAFT_821983; POPTRDRAFT_832809; RCOM_0677750; VITISV_036476; lipoxygenase; lox; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
Sma3 | lipoxygenase activity | GO:0016165 | Molecular Function | 0.0 | - |
Sma3 | oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen | GO:0016702 | Molecular Function | 0.0 | - |
Sma3 | metal ion binding | GO:0046872 | Molecular Function | 0.0 | - |
Sma3 | oxylipin biosynthetic process | GO:0031408 | Biological Process | 0.0 | - |
Sma3 | root development | GO:0048364 | Biological Process | 0.0 | - |
Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Lipoxygenase | IPR000907 | - | 0.0 | - |
Sma3 | Lipoxygenase, LH2 | IPR001024 | - | 0.0 | - |
Sma3 | Lipoxygenase, plant | IPR001246 | - | 0.0 | - |
Sma3 | Lipoxygenase, C-terminal | IPR013819 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G22400.1 | LOX5 PLAT/LH2 domain-containing lipoxygenase family protein chr3:7927011-7931167 FORWARD LENGTH=886 | 6.0e-14 | 73% |
RefSeq | Arabidopsis thaliana | NP_188879.2 | lipoxygenase 5 [Arabidopsis thaliana] | 8.0e-14 | 73% |
RefSeq | Populus trichocarpa | XP_002315780.1 | predicted protein [Populus trichocarpa] | 9.0e-15 | 81% |
![]() |
---|
Fln status: C-terminus
Fln database: coniferopsida.fasta
Fln subject: G9L7U0
Fln msg: your sequence is shorter than subject: 39 - 855
Fln protein:
K
Protein Length:
40
Fln nts:
G
Fln Alignment:
GD4IA4404I6TGZ___KNRCGPAQVPYTLLYPNTSDVSHKGGLTGKGIPNSVSI
G9L7U0_______________KNRSGPVQIPYTLLYPSTSDVSGVGGLTGKGIPNSVSI
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain