UniGene Name: sp_v3.0_unigene79282
Length: 205 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene79282
G |
Ace file of the UniGene sp_v3.0_unigene79282 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Multidrug resistance protein ABC transporter family n=1 Tax=Populus trichocarpa RepID=B9GJX7_POPTR | - | - | 4.0e-24 | 76% |
| FL-Next | Isoform 2 of ABC transporter C family member 3 OS=Arabidopsis thaliana GN=ABCC3 | - | - | 0.0 | 72% |
| Sma3 | Multidrug resistance protein ABC transporter family | - | - | 3.279e-28 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | 2-alkenal reductase. | EC:1.3.1.74 | - | 5.528e-07 | - |
| Sma3 | Xenobiotic-transporting ATPase. | EC:3.6.3.44 | - | 3.809e-25 | - |
| Source | Gene names |
|---|---|
| Sma3 | At1g04120; At1g71330; At2g47800; At3g13080; At3g13090; At3g13100; At3g59140; At3g60160; At3g60970; At3g62700; B1065G12.13; B1157F09.14; EST2; EST3; F17A22.19; F17J16.190; F20D22.11; F26K9.130; F3I17.2; FeMRP3; GSVIVT00011051001; GSVIVT00018959001; GSVIVT0 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | plant-type vacuole | GO:0000325 | Cellular Component | 0.0 | - |
| Sma3 | vacuolar membrane | GO:0005774 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | sulfonylurea receptor activity | GO:0008281 | Molecular Function | 0.0 | - |
| Sma3 | folic acid transporter activity | GO:0008517 | Molecular Function | 0.0 | - |
| Sma3 | xenobiotic-transporting ATPase activity | GO:0008559 | Molecular Function | 0.0 | - |
| Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
| Sma3 | chlorophyll catabolite transmembrane transporter activity | GO:0010290 | Molecular Function | 0.0 | - |
| Sma3 | protein disulfide oxidoreductase activity | GO:0015035 | Molecular Function | 0.0 | - |
| Sma3 | glutathione S-conjugate-exporting ATPase activity | GO:0015431 | Molecular Function | 0.0 | - |
| Sma3 | ATPase activity | GO:0016887 | Molecular Function | 0.0 | - |
| Sma3 | ATPase activity, coupled to transmembrane movement of substances | GO:0042626 | Molecular Function | 0.0 | - |
| Sma3 | transport | GO:0006810 | Biological Process | 0.0 | - |
| Sma3 | response to water deprivation | GO:0009414 | Biological Process | 0.0 | - |
| Sma3 | response to wounding | GO:0009611 | Biological Process | 0.0 | - |
| Sma3 | response to nematode | GO:0009624 | Biological Process | 0.0 | - |
| Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
| Sma3 | stomatal movement | GO:0010118 | Biological Process | 0.0 | - |
| Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
| Sma3 | cellular potassium ion homeostasis | GO:0030007 | Biological Process | 0.0 | - |
| Sma3 | cell redox homeostasis | GO:0045454 | Biological Process | 0.0 | - |
| Sma3 | response to other organism | GO:0051707 | Biological Process | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G13080.1 | ATMRP3, MRP3, ABCC3 multidrug resistance-associated protein 3 chr3:4196019-4201250 REVERSE LENGTH=1514 | 1.0e-28 | 72% |
| RefSeq | Arabidopsis thaliana | NP_974299.1 | ABC transporter C family member 3 [Arabidopsis thaliana] | 1.0e-28 | 72% |
| RefSeq | Populus trichocarpa | XP_002300362.1 | multidrug resistance protein ABC transporter family [Populus trichocarpa] | 3.0e-30 | 76% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q9LK64-2
Fln msg: Distance to subject end: 633 aas, your sequence is shorter than subject: 68 - 1489
Fln protein:
D
Protein Length:
69
Fln nts:
G
Fln Alignment:
GD4IA4404ICXS1___DDPFSAVDAHTGKHIFQECILGILASKTVVYVTHQVEFLPSADIILVMRDGEITQVGRYDDILQSG
Q9LK64-2_____________DDPFSAVDAHTGSHLFKEVLLGLLCSKSVIYVTHQVEFLPAADLILVMKDGRISQAGKYNDILNSG

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta (sense)