UniGene Name: sp_v3.0_unigene79263
Length: 195 nt
![]() |
---|
>sp_v3.0_unigene79263
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Cysteine synthase n=1 Tax=Chlamydomonas reinhardtii RepID=A8J434_CHLRE | - | - | 3.0e-14 | 72% |
FL-Next | sp=Cysteine synthase; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 70% |
Sma3 | Cysteine synthase | - | - | 0.0 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Cysteine synthase. | EC:2.5.1.47 | - | 0.0 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Cysteine and methionine metabolism | 00270 | 0.0 | % | |
Sma3 | Sulfur metabolism | 00920 | 0.0 | % | |
Sma3 | Metabolic pathways | 01100 | 0.0 | % | |
Sma3 | Beta-pyrazolylalanine synthase. | EC:2.5.1.51 | - | 3.815e-06 | - |
Sma3 | Transferred entry: 2.5.1.47. | EC:4.2.99.8 | - | 1.591e-06 | - |
Source | Gene names |
---|---|
Sma3 | ACS 1; AT3G59760; At2g43750; At3g04940; At3g59760; At4g14880; At5g28030; AtcysD1; CHLREDRAFT_175651; CHLREDRAFT_189320; CHLREDRAFT_196886; CS; CYS1; Crcys-1A; Cyt ACS 1; F18O19.14; GSVIVT00031107001; GSVIVT00031113001; LOC_Os12g42980; MICPUCDRAFT_31117; M |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | peroxisome | GO:0005777 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | chromoplast | GO:0009509 | Cellular Component | 0.0 | - |
Sma3 | chloroplast stroma | GO:0009570 | Cellular Component | 0.0 | - |
Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
Sma3 | catalytic activity | GO:0003824 | Molecular Function | 0.0 | - |
Sma3 | cysteine synthase activity | GO:0004124 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | transferase activity | GO:0016740 | Molecular Function | 0.0 | - |
Sma3 | lyase activity | GO:0016829 | Molecular Function | 0.0 | - |
Sma3 | pyridoxal phosphate binding | GO:0030170 | Molecular Function | 0.0 | - |
Sma3 | beta-pyrazolylalanine synthase activity | GO:0047458 | Molecular Function | 0.0 | - |
Sma3 | L-mimosine synthase activity | GO:0050461 | Molecular Function | 0.0 | - |
Sma3 | cysteine biosynthetic process from serine | GO:0006535 | Biological Process | 0.0 | - |
Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Cysteine synthase/cystathionine beta-synthase P-phosphate-binding site | IPR001216 | - | 0.0 | - |
Sma3 | Pyridoxal phosphate-dependent enzyme, beta subunit | IPR001926 | - | 0.0 | - |
Sma3 | Cysteine synthase K/M | IPR005856 | - | 0.0 | - |
Sma3 | Cysteine synthase A | IPR005859 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G14880.1 | OASA1, OLD3, CYTACS1 O-acetylserine (thiol) lyase (OAS-TL) isoform A1 chr4:8518209-8520050 REVERSE LENGTH=322 | 1.0e-16 | 69% |
RefSeq | Arabidopsis thaliana | NP_001190733.1 | cysteine synthase [Arabidopsis thaliana] | 2.0e-16 | 69% |
RefSeq | Populus trichocarpa | XP_002330649.1 | predicted protein, partial [Populus trichocarpa] | 9.0e-17 | 60% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NS10
Fln msg: Distance to subject end: 59 aas, your sequence is shorter than subject: 64 - 401
Fln protein:
Q
Protein Length:
65
Fln nts:
C
Fln Alignment:
GD4IA4404I40EN___VAVEPKESPVISGGAPGGHKIQGIGAGFIPKNLNLDILDETIQVTSDE
A9NS10_______________IGVEPTESNILSGGKPGPHKIQGIGAGFIPRNLDVDILDEVIQISSDE
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain