|
||||||
|
UniGene Name: sp_v3.0_unigene79235
Length: 170 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene79235
G |
|
Ace file of the UniGene sp_v3.0_unigene79235
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Abietadiene synthase, chloroplastic n=1 Tax=Abies grandis RepID=TPSDV_ABIGR | - | - | 3.0e-15 | 72% |
| FL-Next | sp=Levopimaradiene synthase, chloroplastic; Pinus taeda (Loblolly pine). | - | - | 0.0 | 72% |
| Sma3 | Copalyl diphosphate synthase | - | - | 9.756e-19 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Levopimaradiene synthase. | EC:4.2.3.32 | - | 2.911e-13 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Diterpenoid biosynthesis | 00904 | 2.911e-13 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 2.911e-13 | % | |
| Sma3 | Copalyl diphosphate synthase. | EC:5.5.1.12 | - | 1.232e-21 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Diterpenoid biosynthesis | 00904 | 1.232e-21 | % | |
| Sma3 | Biosynthesis of terpenoids and steroids | 01062 | 1.232e-21 | % | |
| Sma3 | Metabolic pathways | 01100 | 1.232e-21 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 1.232e-21 | % |
| Source | Gene names |
|---|---|
| Sma3 | ABS; LPS; TPS-ISO; TPS-LAS; ac22; ag22; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | magnesium ion binding | GO:0000287 | Molecular Function | 0.0 | - |
| Sma3 | lyase activity | GO:0016829 | Molecular Function | 0.0 | - |
| Sma3 | carbon-oxygen lyase activity, acting on phosphates | GO:0016838 | Molecular Function | 0.0 | - |
| Sma3 | manganese ion binding | GO:0030145 | Molecular Function | 0.0 | - |
| Sma3 | abietadiene synthase activity | GO:0050554 | Molecular Function | 0.0 | - |
| Sma3 | copalyl diphosphate synthase activity | GO:0050559 | Molecular Function | 0.0 | - |
| Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Prenyltransferase/squalene oxidase | IPR001330 | - | 0.0 | - |
| Sma3 | Terpene synthase-like | IPR001906 | - | 0.0 | - |
| Sma3 | Terpene synthase, metal-binding domain | IPR005630 | - | 0.0 | - |
| Sma3 | Terpenoid synthase | IPR008949 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G02780.1 | GA1, ABC33, ATCPS1, CPS, CPS1 Terpenoid cyclases/Protein prenyltransferases superfamily protein chr4:1237881-1244766 REVERSE LENGTH=802 | 8.0e-12 | 54% |
| RefSeq | Arabidopsis thaliana | NP_192187.1 | Ent-copalyl diphosphate synthase [Arabidopsis thaliana] | 1.0e-11 | 54% |
| RefSeq | Populus trichocarpa | XP_002306777.1 | copalyl diphosphate synthase [Populus trichocarpa] | 1.0e-12 | 50% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: Q50EK2
Fln msg: Distance to subject end: 446 aas, your sequence is shorter than subject: 56 - 850
Fln protein:
P
Protein Length:
57
Fln nts:
G
Fln Alignment:
GD4IA4404JNAKI___DQADSGMDYIYSHWNERGIGWARENHVADIDVTAMGLRMLRLHGYNLSSD
Q50EK2_______________EEIKDALDYVYSHWDERGIGWARENPVPDIDDTAMGLRILRLHGYNVSSD
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
