UniGene Name: sp_v3.0_unigene79198
Length: 236 nt
![]() |
---|
>sp_v3.0_unigene79198
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] sp|Q9FJY7.1|PP449_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g66520 dbj|BAB10928.1| selenium-binding protein-like [Arabidopsis thaliana] gb|AED98224.1| pentatricope | - | - | 2.0e-22 | 63% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 70% |
Sma3 | Tetratricopeptide-like helical | - | - | 3.157e-12 | - |
Source | Gene names |
---|---|
Sma3 | At1g06140; At1g20230; At2g01510; At3g11460; At3g13770; At4g01030; At4g16835; At4g19191; At4g21300; At4g33990; At5g08510; At5g44230; At5g48910; At5g66520; B1032F05.19; DYW10; EMB2758; F17I5.180; F24K9.13; F2I9.13; F3I3.50; F8L15.21; FCAALL.441; GSVIVT00000 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | diacylglycerol kinase activity | GO:0004143 | Molecular Function | 0.0 | - |
Sma3 | ubiquitin thiolesterase activity | GO:0004221 | Molecular Function | 0.0 | - |
Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
Sma3 | deaminase activity | GO:0019239 | Molecular Function | 0.0 | - |
Sma3 | ubiquitin-dependent protein catabolic process | GO:0006511 | Biological Process | 0.0 | - |
Sma3 | activation of protein kinase C activity by G-protein coupled receptor protein signaling pathway | GO:0007205 | Biological Process | 0.0 | - |
Sma3 | purine ribonucleoside monophosphate biosynthetic process | GO:0009168 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Ribonuclease P | IPR000100 | - | 0.0 | - |
Sma3 | Armadillo | IPR000225 | - | 0.0 | - |
Sma3 | Serine/threonine dehydratase, pyridoxal-phosphate-binding site | IPR000634 | - | 0.0 | - |
Sma3 | Diacylglycerol kinase, accessory domain | IPR000756 | - | 0.0 | - |
Sma3 | Beta-lactamase, class-A/D | IPR000871 | - | 0.0 | - |
Sma3 | Diacylglycerol kinase, catalytic domain | IPR001206 | - | 0.0 | - |
Sma3 | Adenosine/AMP deaminase domain | IPR001365 | - | 0.0 | - |
Sma3 | Peptidase C12, ubiquitin carboxyl-terminal hydrolase 1 | IPR001578 | - | 0.0 | - |
Sma3 | Pentatricopeptide repeat | IPR002885 | - | 0.0 | - |
Sma3 | Immunoglobulin/major histocompatibility complex, conserved site | IPR003006 | - | 0.0 | - |
Sma3 | Phosphopantetheine attachment site | IPR006162 | - | 0.0 | - |
Sma3 | Uncharacterised protein family UPF0497, trans-membrane plant | IPR006702 | - | 0.0 | - |
Sma3 | Armadillo-like helical | IPR011989 | - | 0.0 | - |
Sma3 | Tetratricopeptide-like helical | IPR011990 | - | 0.0 | - |
Sma3 | Asp/Glu racemase, active site | IPR018187 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G66520.1 | Tetratricopeptide repeat (TPR)-like superfamily protein chr5:26551879-26553741 FORWARD LENGTH=620 | 2.0e-28 | 63% |
RefSeq | Arabidopsis thaliana | NP_201453.1 | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] | 3.0e-28 | 63% |
RefSeq | Populus trichocarpa | XP_002320193.1 | predicted protein [Populus trichocarpa] | 3.0e-30 | 61% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5ADG9
Fln msg: Distance to subject end: 178 aas, your sequence is shorter than subject: 78 - 312
Fln protein:
L
Protein Length:
79
Fln nts:
A
Fln Alignment:
GD4IA4404JAGQH___LDEGWQIFDSMIRDYDIRPSVEHYACMVDLLGRVGRLDEAEDFIKKMPLKPDAGVWGALLGACRIHCNIELGGRVAE
D5ADG9_______________VDEGWKCYNCMTLDYAITPTVEHYACMVDLLGRAGHLNEAWDFIEKMPIEPGASVWGAFLGSCRIHCNIELGERVAE
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain