UniGene Name: sp_v3.0_unigene79166
Length: 184 nt
UniGene Fasta |
---|
>sp_v3.0_unigene79166
C |
Ace file of the UniGene sp_v3.0_unigene79166 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Glyceraldehyde-3-phosphate dehydrogenase (Fragment) n=1 Tax=Metridium senile RepID=C7SP38_METSE | - | - | 2.0e-14 | 88% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 77% |
Sma3 | Glyceraldehyde-3-phosphate dehydrogenase | - | - | 0.0 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Glyceraldehyde-3-phosphate dehydrogenase (phosphorylating). | EC:1.2.1.12 | - | 0.0 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Glycolysis / Gluconeogenesis | 00010 | 0.0 | % | |
Sma3 | Biosynthesis of phenylpropanoids | 01061 | 0.0 | % | |
Sma3 | Biosynthesis of terpenoids and steroids | 01062 | 0.0 | % | |
Sma3 | Biosynthesis of alkaloids derived from shikimate pathway | 01063 | 0.0 | % | |
Sma3 | Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid | 01064 | 0.0 | % | |
Sma3 | Biosynthesis of alkaloids derived from histidine and purine | 01065 | 0.0 | % | |
Sma3 | Biosynthesis of alkaloids derived from terpenoid and polyketide | 01066 | 0.0 | % | |
Sma3 | Biosynthesis of plant hormones | 01070 | 0.0 | % | |
Sma3 | Metabolic pathways | 01100 | 0.0 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 0.0 | % |
Source | Gene names |
---|---|
Sma3 | AT1G13440; At1g13440; At1g16300; At1g79530; At1g79530/T8K14_5; At3g04120; F3O9.10; FaGAPDH; G3PDH; GAPC; GAPC1; GAPC2; GAPC3; GAPD4; GAPDH; GAPDHc; GPC; GPC1; GPC2; GPC3; GPD1; GPDA; GSVIVT00002074001; GSVIVT00009717001; GSVIVT00020570001; GSVIVT000350970 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | mitochondrial envelope | GO:0005740 | Cellular Component | 0.0 | - |
Sma3 | cytosol | GO:0005829 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
Sma3 | glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity | GO:0004365 | Molecular Function | 0.0 | - |
Sma3 | triose-phosphate isomerase activity | GO:0004807 | Molecular Function | 0.0 | - |
Sma3 | NAD binding | GO:0051287 | Molecular Function | 0.0 | - |
Sma3 | glucose metabolic process | GO:0006006 | Biological Process | 0.0 | - |
Sma3 | glycolysis | GO:0006096 | Biological Process | 0.0 | - |
Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | IPR000173 | - | 0.0 | - | |
Sma3 | Triosephosphate isomerase | IPR000652 | - | 0.0 | - |
Sma3 | Glyceraldehyde-3-phosphate dehydrogenase, type I | IPR006424 | - | 0.0 | - |
Sma3 | Aldolase-type TIM barrel | IPR013785 | - | 0.0 | - |
Sma3 | NAD(P)-binding domain | IPR016040 | - | 0.0 | - |
Sma3 | CS domain | IPR017447 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G79530.1 | GAPCP-1 glyceraldehyde-3-phosphate dehydrogenase of plastid 1 chr1:29916232-29919088 REVERSE LENGTH=422 | 3.0e-16 | 75% |
RefSeq | Arabidopsis thaliana | NP_178071.1 | glyceraldehyde 3-phosphate dehydrogenase [Arabidopsis thaliana] | 4.0e-16 | 75% |
RefSeq | Populus trichocarpa | XP_002321679.1 | predicted protein [Populus trichocarpa] | 2.0e-16 | 77% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: C0PRY5
Fln msg: Distance to subject end: 171 aas, your sequence is shorter than subject: 60 - 400
Fln protein:
K
Protein Length:
61
Fln nts:
C
Fln Alignment:
GD4IA4404IW3KQ___KASLHLKGGAKKVIISAPSNDAPMFVMGVNENSYDKSMDVISNA
C0PRY5_______________KASAHLKGGAKKVVISAPSADAPMFVVGVNEGSYKPEMSVVSNA
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain