UniGene Name: sp_v3.0_unigene79053
Length: 204 nt
UniGene Fasta |
---|
>sp_v3.0_unigene79053
G |
Ace file of the UniGene sp_v3.0_unigene79053 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | ADP ribosylation factor 1, putative n=1 Tax=Perkinsus marinus ATCC 50983 RepID=C5LJ98_9ALVE | - | - | 7.0e-18 | 78% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 76% |
Sma3 | ADP-ribosylation factor | - | - | 3.843e-20 | - |
Source | Gene names |
---|---|
Sma3 | 24.t00012; ARF; ARF1; ARF2-A; ARF2-B; ARF3; ARFA1-A; ARFA1-D; ARFA1A; ARFA1B; ARFA2-A; ARFA2-B; ARL1; Arf; Arf1; ArfA11; ArfA12; ArfA13; ArfA14; ArfA15; ArfB1A1; ArfB1B1; At1g10630; At1g23490; At1g70490; At2g15310; At3g62290; At5g14670; CGL49; CHLREDRAFT_ |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
Sma3 | endosome | GO:0005768 | Cellular Component | 0.0 | - |
Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
Sma3 | Golgi apparatus | GO:0005794 | Cellular Component | 0.0 | - |
Sma3 | plastid | GO:0009536 | Cellular Component | 0.0 | - |
Sma3 | signal transducer activity | GO:0004871 | Molecular Function | 0.0 | - |
Sma3 | calcium ion binding | GO:0005509 | Molecular Function | 0.0 | - |
Sma3 | GTP binding | GO:0005525 | Molecular Function | 0.0 | - |
Sma3 | small GTPase mediated signal transduction | GO:0007264 | Biological Process | 0.0 | - |
Sma3 | protein transport | GO:0015031 | Biological Process | 0.0 | - |
Sma3 | vesicle-mediated transport | GO:0016192 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | PAS | IPR000014 | - | 0.0 | - |
Sma3 | Calcium-binding EF-hand | IPR002048 | - | 0.0 | - |
Sma3 | Small GTP-binding protein domain | IPR005225 | - | 0.0 | - |
Sma3 | IPR006688 | - | 0.0 | - | |
Sma3 | Small GTPase superfamily, ARF/SAR type | IPR006689 | - | 0.0 | - |
Sma3 | EF-hand-like domain | IPR011992 | - | 0.0 | - |
Sma3 | EF-Hand 1, calcium-binding site | IPR018247 | - | 0.0 | - |
Sma3 | EF-hand | IPR018248 | - | 0.0 | - |
Sma3 | EF-HAND 2 | IPR018249 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G62290.1 | ATARFA1E, ARFA1E ADP-ribosylation factor A1E chr3:23052287-23053545 FORWARD LENGTH=181 | 6.0e-24 | 76% |
RefSeq | Arabidopsis thaliana | NP_001190162.1 | ADP-ribosylation factor A1E [Arabidopsis thaliana] | 8.0e-24 | 76% |
RefSeq | Populus trichocarpa | XP_002312302.1 | predicted protein [Populus trichocarpa] | 7.0e-24 | 76% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: C0PPL2
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 89 aas, your sequence is shorter than subject: 58 - 181
Fln protein:
T
Protein Length:
59
Fln nts:
G
Fln Alignment:
GD4IA4404I52O6___LLCKKPLEKLVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHL*PQLHGL
C0PPL2_______________ILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain