SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene78957

Length: 345 nt

UniGene Fasta

>sp_v3.0_unigene78957
CAAAGCTTTACTCCAAGAAAATATTCCATGGAGATGTCATCCAAGATATATAAAGATTGGAAGTTTAACGAACAAGGATTGCCGGCAGATCTTCTTAAAAGAGGAATGGCTATTCGAGACCCAACATCACCCCATGGGCTAAAGCTTATGATTGAAGATTACCCATTTGCTGTAGATGGTCTAGAACTATGGTTTTCTATGAAACAATGGGTTTCAGAGAAAACCATAGTTCTATTACAAAGATGATGCATCAATGGAAAGAGATAAAGAATTGCAAGCTTGGTGGAGTGAGATTGTAAATGTTGGGCATGGAGATCTTAAGGATGATTTAAATAGATGGTACAA

Ace file of the UniGene sp_v3.0_unigene78957

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	Identity
AutoFact	Lipoxygenase n=1 Tax=Picea sitchensis RepID=B8LLK5_PICSI	-	-	81%
FL-Next	sp=Lipoxygenase; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	81%
Sma3	Lipoxygenase	-	-	-

Source	ECs	Term	Type	e value	Identity
Sma3	Lipoxygenase.	EC:1.13.11.12	-	0.0	-

Source	KEGGs	Term	Identity
Sma3	Linoleic acid metabolism	00591	%
Sma3	alpha-Linolenic acid metabolism	00592	%
Sma3	Biosynthesis of plant hormones	01070	%
Sma3	Metabolic pathways	01100	%

Source	Gene names
Sma3	At1g17420; At1g55020; At1g72520; At3g45140; B1168A08.24; B1168A08.28-1; B1168A08.28-2; CM-LOX1; CM-LOX2; F14C21.3; F14C21.54; F28G4.10; F28P22.29; GSVIVT00008869001; GSVIVT00019960001; GSVIVT00022800001; GSVIVT00022801001; GSVIVT00024673001; GSVIVT0002467

Source	GOs	Term	Type	Identity
Sma3	cytoplasm	GO:0005737	Cellular Component	-
Sma3	chloroplast	GO:0009507	Cellular Component	-
Sma3	chloroplast thylakoid membrane	GO:0009535	Cellular Component	-
Sma3	chloroplast stroma	GO:0009570	Cellular Component	-
Sma3	chloroplast envelope	GO:0009941	Cellular Component	-
Sma3	iron ion binding	GO:0005506	Molecular Function	-
Sma3	protein binding	GO:0005515	Molecular Function	-
Sma3	electron carrier activity	GO:0009055	Molecular Function	-
Sma3	lipoxygenase activity	GO:0016165	Molecular Function	-
Sma3	oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen	GO:0016702	Molecular Function	-
Sma3	metal ion binding	GO:0046872	Molecular Function	-
Sma3	response to fungus	GO:0009620	Biological Process	-
Sma3	jasmonic acid biosynthetic process	GO:0009695	Biological Process	-
Sma3	response to jasmonic acid stimulus	GO:0009753	Biological Process	-
Sma3	oxylipin biosynthetic process	GO:0031408	Biological Process	-
Sma3	root development	GO:0048364	Biological Process	-
Sma3	oxidation-reduction process	GO:0055114	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Ketose-bisphosphate aldolase, class-II	IPR000771	-	-
Sma3	Peptidase M14, carboxypeptidase A	IPR000834	-	-
Sma3	Lipoxygenase	IPR000907	-	-
Sma3	Lipoxygenase, LH2	IPR001024	-	-
Sma3	WW/Rsp5/WWP	IPR001202	-	-
Sma3	Lipoxygenase, plant	IPR001246	-	-
Sma3	Short-chain dehydrogenase/reductase SDR	IPR002198	-	-
Sma3	Lipoxygenase, C-terminal	IPR013819	-	-
Sma3	Hemopexin/matrixin, conserved site	IPR018486	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT3G22400.1	LOX5 PLAT/LH2 domain-containing lipoxygenase family protein chr3:7927011-7931167 FORWARD LENGTH=886	5.0e-31	66%
RefSeq	Arabidopsis thaliana	NP_188879.2	lipoxygenase 5 [Arabidopsis thaliana]	7.0e-31	66%
RefSeq	Populus trichocarpa	XP_002319014.1	predicted protein [Populus trichocarpa]	4.0e-34	63%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: B8LLK5

Fln msg: Separated hits, possible frame ERROR between 219 and 233, Distance to subject end: 177 aas, your sequence is shorter than subject: 115 - 930

Fln protein: QSFTPRKYSMEMSSKIYKDWKFNEQGLPADLLKRGMAIRDPTSPHGLKLMIEDYPFAVDGLELWFSMKQWVSxxxxxxYYKDDASMERDKELQAWWSEIVNVGHGDLKDDLNRWY

Protein Length: 116

Fln nts: CAAAGCTTTACTCCAAGAAAATATTCCATGGAGATGTCATCCAAGATATATAAAGATTGGAAGTTTAACGAACAAGGATTGCCGGCAGATCTTCTTAAAAGAGGAATGGCTATTCGAGACCCAACATCACCCCATGGGCTAAAGCTTATGATTGAAGATTACCCATTTGCTGTAGATGGTCTAGAACTATGGTTTTCTATGAAACAATGGGTTTCAGAxxxxxxxxxxxxxxxCTATTACAAAGATGATGCATCAATGGAAAGAGATAAAGAATTGCAAGCTTGGTGGAGTGAGATTGTAAATGTTGGGCATGGAGATCTTAAGGATGATTTAAATAGATGGTACAA

Fln Alignment:

GD4IA4404IMWSM___FTPRKYSMEMSSKIYKDWKFNEQGLPADLLKRGMAIRDPTSPHGLKLMIEDYPFAVDGLELWFSMKQWVSExxxxxYYKDDASMERDKELQAWWSEIVNVGHGDLKDDLNRWY
B8LLK5_______________FTPGKYSTEMSSKIYKEWKFNEQGLPADLLKRGMAVRNPTSPYGLKLVIEDYPYAVDGLEIWLSLKEWVSDxxxxxYYKDDASIKRDQELQAWWNEIVNVGHGDLKDDPSRWY

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain