UniGene Name: sp_v3.0_unigene78953
Length: 188 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene78953
T |
Ace file of the UniGene sp_v3.0_unigene78953 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | S-locus lectin protein kinase-like protein [Arabidopsis thaliana] sp|O64477.1|Y2913_ARATH RecName: Full=G-type lectin S-receptor-like serine/threonine-protein kinase At2g19130; Flags: Precursor gb|AAD12030.1| putative receptor-like protein kinase [Arabido | - | - | 3.0e-18 | 81% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 59% |
| Sma3 | S-domain receptor-like protein kinase | - | - | 1.646e-15 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Non-specific protein-tyrosine kinase. | EC:2.7.10.2 | - | 9.704e-07 | - |
| Sma3 | [Myosin light-chain] kinase. | EC:2.7.11.18 | - | 4.71e-08 | - |
| Source | Gene names |
|---|---|
| Sma3 | 17L07.5; AT4g00340; AT4g32300; A_IG005I10.19; At1g34300; At2g19130; At4g32300; B1099D03.46; B1099D03.51; DUPR11.18; F10M6.60; F23M19.5; F5I10.19; F8B4.10; GSVIVT00000338001; GSVIVT00001733001; GSVIVT00001735001; GSVIVT00014888001; GSVIVT00014890001; GSVIV |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | cell surface | GO:0009986 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | phospholipase C activity | GO:0004629 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
| Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | sugar binding | GO:0005529 | Molecular Function | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | lipid metabolic process | GO:0006629 | Biological Process | 0.0 | - |
| Sma3 | GO:0007242 | Biological Process | 0.0 | - | |
| Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
| Sma3 | recognition of pollen | GO:0048544 | Biological Process | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G19130.1 | S-locus lectin protein kinase family protein chr2:8293789-8296275 FORWARD LENGTH=828 | 2.0e-23 | 81% |
| RefSeq | Arabidopsis thaliana | NP_179503.1 | S-locus lectin protein kinase-like protein [Arabidopsis thaliana] | 2.0e-23 | 81% |
| RefSeq | Populus trichocarpa | XP_002325680.1 | predicted protein [Populus trichocarpa] | 2.0e-25 | 77% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NM60
Fln msg: Distance to subject end: 180 aas, your sequence is shorter than subject: 62 - 431
Fln protein:
L
Protein Length:
63
Fln nts:
T
Fln Alignment:
GD4IA4404J2YQL___NQNKILDWKTRFAIAVGTARGIAYLHEQCRDCIIHCDIKPENILLDSNFCPK
A9NM60_______________DSDKWLDWKTRYSIALDTARGLAYLHEESRLCILHLDVKPQNILVDEYFKAK

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta (sense)