UniGene Name: sp_v3.0_unigene78898
Length: 158 nt
![]() |
---|
>sp_v3.0_unigene78898
G |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Blue light photoreceptor n=1 Tax=Adiantum capillus-veneris RepID=Q9S7R6_ADICA | - | - | 1.0e-19 | 88% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 82% |
Sma3 | Cryptochrome 2 | - | - | 8.169e-31 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Deoxyribodipyrimidine photo-lyase. | EC:4.1.99.3 | - | 2.695e-06 | - |
Source | Gene names |
---|---|
Sma3 | Arcry2-1; Arcry2-2; Arcry2-3; Arcry2-4; At1g04400; B1215B07.27-1; CRY1; CRY1a; CRY2; CRY2A; CRY2B; CRY3; CRY4; CRY5; Cry1a; Cry1b; Cry2; F19P19.14; GSVIVT00015232001; GSVIVT00020260001; H0815C01.8; MpCRY; MpCRYG; MtrDRAFT_AC174468g14v1; OSJNBa0086B14.23; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
Sma3 | DNA photolyase activity | GO:0003913 | Molecular Function | 0.0 | - |
Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | photoreceptor activity | GO:0009881 | Molecular Function | 0.0 | - |
Sma3 | blue light photoreceptor activity | GO:0009882 | Molecular Function | 0.0 | - |
Sma3 | protein homodimerization activity | GO:0042803 | Molecular Function | 0.0 | - |
Sma3 | DNA repair | GO:0006281 | Biological Process | 0.0 | - |
Sma3 | chromatin remodeling | GO:0006338 | Biological Process | 0.0 | - |
Sma3 | response to water deprivation | GO:0009414 | Biological Process | 0.0 | - |
Sma3 | phototropism | GO:0009638 | Biological Process | 0.0 | - |
Sma3 | positive regulation of flower development | GO:0009911 | Biological Process | 0.0 | - |
Sma3 | regulation of meristem growth | GO:0010075 | Biological Process | 0.0 | - |
Sma3 | stomatal movement | GO:0010118 | Biological Process | 0.0 | - |
Sma3 | circadian regulation of calcium ion oscillation | GO:0010617 | Biological Process | 0.0 | - |
Sma3 | protein-chromophore linkage | GO:0018298 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Cryptochrome/DNA photolyase, class 1 | IPR002081 | - | 0.0 | - |
Sma3 | DNA photolyase, FAD-binding/Cryptochrome, C-terminal | IPR005101 | - | 0.0 | - |
Sma3 | DNA photolyase, N-terminal | IPR006050 | - | 0.0 | - |
Sma3 | Cryptochrome, plant | IPR014134 | - | 0.0 | - |
Sma3 | Rossmann-like alpha/beta/alpha sandwich fold | IPR014729 | - | 0.0 | - |
Sma3 | Cryptochrome/DNA photolyase, class 1 conserved site, C-terminal | IPR018394 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G04400.2 | CRY2, FHA, AT-PHH1, PHH1, ATCRY2 cryptochrome 2 chr1:1185719-1187901 REVERSE LENGTH=612 | 1.0e-23 | 86% |
RefSeq | Arabidopsis thaliana | NP_849588.1 | cryptochrome 2 [Arabidopsis thaliana] | 2.0e-23 | 86% |
RefSeq | Populus trichocarpa | XP_002332746.1 | predicted protein [Populus trichocarpa] | 1.0e-22 | 84% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LPX1
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 267 aas, your sequence is shorter than subject: 52 - 655
Fln protein:
*
Protein Length:
53
Fln nts:
G
Fln Alignment:
GD4IA4404JOL5V___WATGWIHNRIRVIVSSFCVKFLQLPWTWGMKYFWDTLLDADIEAD
B8LPX1_______________WATGWLHDRIRVVVSSFFVKVLQLPWRWGMKYFWDTLLDADLECD
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain