UniGene Name: sp_v3.0_unigene78884
Length: 159 nt
![]() |
---|
>sp_v3.0_unigene78884
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | vesicle-fusing ATPase [Strongylocentrotus purpuratus] gb|AAG17479.1| N-ethylmaleimide-sensitive factor [Strongylocentrotus purpuratus] | - | - | 4.0e-08 | 90% |
FL-Next | sp=Vesicle-fusing ATPase; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 86% |
Sma3 | N-ethylmaleimide sensitive fusion protein | - | - | 1.266e-12 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Adenosinetriphosphatase. | EC:3.6.1.3 | - | 3.522e-06 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Purine metabolism | 00230 | 3.522e-06 | % | |
Sma3 | Vesicle-fusing ATPase. | EC:3.6.4.6 | - | 1.176e-08 | - |
Source | Gene names |
---|---|
Sma3 | At4g04910; CHLREDRAFT_187761; GSVIVT00027677001; MICPUCDRAFT_1003; MICPUCDRAFT_31131; MICPUN_106780; MICPUN_113384; NSF; NSFA; NtNSF-1; OSTLU_30476; OSTLU_41487; Os05g0519400; OsI_20653; OsJ_19229; Ot02g05040; Ot03g01440; P0599F04.10; PHATRDRAFT_12252; PH |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
Sma3 | cytosol | GO:0005829 | Cellular Component | 0.0 | - |
Sma3 | protein complex | GO:0043234 | Cellular Component | 0.0 | - |
Sma3 | magnesium ion binding | GO:0000287 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | nucleoside-triphosphatase activity | GO:0017111 | Molecular Function | 0.0 | - |
Sma3 | ATPase activity, uncoupled | GO:0042624 | Molecular Function | 0.0 | - |
Sma3 | protein transport | GO:0015031 | Biological Process | 0.0 | - |
Sma3 | vesicle-mediated transport | GO:0016192 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | CDC48, N-terminal subdomain | IPR003338 | - | 0.0 | - |
Sma3 | AAA+ ATPase domain | IPR003593 | - | 0.0 | - |
Sma3 | ATPase, AAA-type, core | IPR003959 | - | 0.0 | - |
Sma3 | ATPase, AAA-type, conserved site | IPR003960 | - | 0.0 | - |
Sma3 | CDC48, domain 2 | IPR004201 | - | 0.0 | - |
Sma3 | Aspartate decarboxylase-like fold | IPR009010 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G04910.1 | NSF AAA-type ATPase family protein chr4:2489696-2495666 REVERSE LENGTH=742 | 1.0e-11 | 86% |
RefSeq | Arabidopsis thaliana | NP_192400.2 | vesicle-fusing ATPase [Arabidopsis thaliana] | 2.0e-11 | 86% |
RefSeq | Populus trichocarpa | XP_002305796.1 | predicted protein [Populus trichocarpa] | 2.0e-11 | 86% |
![]() |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q9M0Y8
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 345 aas, your sequence is shorter than subject: 52 - 742
Fln protein:
S
Protein Length:
53
Fln nts:
A
Fln Alignment:
GD4IA4404INZRP___GMTNRKDLIDEALLRPGRLEIQIEIGLPDE
Q9M0Y8_______________GMTNRKDLLDEALLRPGRLEVQVEISLPDE
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain