UniGene Name: sp_v3.0_unigene78825
Length: 190 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense) |
---|
>sp_v3.0_unigene78825
C |
Ace file of the UniGene sp_v3.0_unigene78825 (antisense) |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Gulonolactone oxidase, putative n=1 Tax=Ricinus communis RepID=B9R807_RICCO | - | - | 4.0e-20 | 74% |
FL-Next | sp=Cytokinin dehydrogenase 5; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 70% |
Sma3 | Cytokinin oxidase | - | - | 2.763e-36 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Cytokinin dehydrogenase. | EC:1.5.99.12 | - | 6.172e-28 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Zeatin biosynthesis | 00908 | 6.172e-28 | % |
Source | Gene names |
---|---|
Sma3 | At1g75450; At2g19500; At2g41510; At3g63440; At4g29740; At5g56970; B1046G12.8; B1131G07.3; B1131G07.5; B1150F11.25; BoCKX1; BrCKX1; CKX; CKX1; CKX2; CKX3; CKX4; CKX5; CKX6; CKX7; F1B16.2; F3P11.10; GSVIVT00013006001; GSVIVT00014541001; GSVIVT00016550001; G |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | extracellular region | GO:0005576 | Cellular Component | 0.0 | - |
Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
Sma3 | endoplasmic reticulum | GO:0005783 | Cellular Component | 0.0 | - |
Sma3 | endoplasmic reticulum lumen | GO:0005788 | Cellular Component | 0.0 | - |
Sma3 | primary amine oxidase activity | GO:0008131 | Molecular Function | 0.0 | - |
Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
Sma3 | cytokinin dehydrogenase activity | GO:0019139 | Molecular Function | 0.0 | - |
Sma3 | flavin adenine dinucleotide binding | GO:0050660 | Molecular Function | 0.0 | - |
Sma3 | cytokinin metabolic process | GO:0009690 | Biological Process | 0.0 | - |
Sma3 | cytokinin catabolic process | GO:0009823 | Biological Process | 0.0 | - |
Sma3 | inflorescence development | GO:0010229 | Biological Process | 0.0 | - |
Sma3 | meristem development | GO:0048507 | Biological Process | 0.0 | - |
Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Oxygen oxidoreductase covalent FAD-binding site | IPR006093 | - | 0.0 | - |
Sma3 | FAD linked oxidase, N-terminal | IPR006094 | - | 0.0 | - |
Sma3 | Cytokinin dehydrogenase 1, FAD/cytokinin binding domain | IPR015345 | - | 0.0 | - |
Sma3 | FAD-binding, type 2 | IPR016166 | - | 0.0 | - |
Sma3 | FAD-binding, type 2, subdomain 1 | IPR016167 | - | 0.0 | - |
Sma3 | FAD-linked oxidase, FAD-binding, subdomain 2 | IPR016168 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G75450.1 | CKX5, ATCKX5, ATCKX6 cytokinin oxidase 5 chr1:28315248-28318064 REVERSE LENGTH=540 | 5.0e-25 | 70% |
RefSeq | Arabidopsis thaliana | NP_001185402.1 | cytokinin dehydrogenase 5 [Arabidopsis thaliana] | 6.0e-25 | 70% |
RefSeq | Populus trichocarpa | XP_002332424.1 | cytokinin oxidase [Populus trichocarpa] | 4.0e-24 | 67% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q67YU0
Fln msg: Distance to subject end: 111 aas, your sequence is shorter than subject: 62 - 540
Fln protein:
E
Protein Length:
63
Fln nts:
C
Fln Alignment:
GD4IA4403GDUAJ___ELKLRSKGLWDVPHPWLNLLVPGSKIQEFDARVFKDILRNTSSGPILIYPMNSNTWDKRMSA
Q67YU0_______________ELKLRSKNLWEVPHPWLNLFVPKSRISDFDKGVFKGILGNKTSGPILIYPMNKDKWDERSSA
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain