UniGene Name: sp_v3.0_unigene78806
Length: 188 nt
UniGene Fasta |
---|
>sp_v3.0_unigene78806
A |
Ace file of the UniGene sp_v3.0_unigene78806 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Phosphoribulokinase n=3 Tax=Physcomitrella patens subsp. patens RepID=A9RPJ4_PHYPA | - | - | 3.0e-15 | 95% |
FL-Next | sp=Phosphoribulokinase, chloroplastic; Spinacia oleracea (Spinach). | - | - | 0.0 | 85% |
Sma3 | Phosphoribulokinase | - | - | 2.643e-21 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Phosphoribulokinase. | EC:2.7.1.19 | - | 9.596e-28 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Carbon fixation in photosynthetic organisms | 00710 | 9.596e-28 | % | |
Sma3 | Metabolic pathways | 01100 | 9.596e-28 | % |
Source | Gene names |
---|---|
Sma3 | At1g32060; MICPUCDRAFT_49540; MICPUN_104911; OSTLU_45513; Os02g0698000; OsI_08574; OsJ_08032; Ot04g02900; P0459B01.11; PHYPADRAFT_108642; PHYPADRAFT_232765; PHYPADRAFT_62365; POPTRDRAFT_712554; POPTRDRAFT_740043; PRK; Prk; T12O21.4; To77-13; VITISV_011191 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | chloroplast thylakoid membrane | GO:0009535 | Cellular Component | 0.0 | - |
Sma3 | chloroplast stroma | GO:0009570 | Cellular Component | 0.0 | - |
Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | phosphoribulokinase activity | GO:0008974 | Molecular Function | 0.0 | - |
Sma3 | kinase activity | GO:0016301 | Molecular Function | 0.0 | - |
Sma3 | carbohydrate metabolic process | GO:0005975 | Biological Process | 0.0 | - |
Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
Sma3 | response to cold | GO:0009409 | Biological Process | 0.0 | - |
Sma3 | reductive pentose-phosphate cycle | GO:0019253 | Biological Process | 0.0 | - |
Sma3 | defense response to bacterium | GO:0042742 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Phosphoribulokinase | IPR006082 | - | 0.0 | - |
Sma3 | Phosphoribulokinase/uridine kinase | IPR006083 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G32060.1 | PRK phosphoribulokinase chr1:11532668-11534406 FORWARD LENGTH=395 | 2.0e-18 | 83% |
RefSeq | Arabidopsis thaliana | NP_174486.1 | phosphoribulokinase [Arabidopsis thaliana] | 2.0e-18 | 83% |
RefSeq | Populus trichocarpa | XP_002326572.1 | predicted protein [Populus trichocarpa] | 2.0e-19 | 85% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: P09559
Fln msg: Distance to subject end: 129 aas, your sequence is shorter than subject: 62 - 402
Fln protein:
L
Protein Length:
63
Fln nts:
A
Fln Alignment:
GD4IA4404H8IML___EFDAYIDPQKQYADVVIQVLPTELIPDDNEGKVLRVRMVMKE
P09559_______________DFDAYIDPQKQHADVVIEVLPTELIPDDDEGKVLRVRMIQKE
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain