UniGene Name: sp_v3.0_unigene78768
Length: 247 nt
![]() |
---|
>sp_v3.0_unigene78768
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | ATCSLC08; cellulose synthase/ transferase, transferring glycosyl groups | - | - | 2.0e-15 | 72% |
FL-Next | tr=Cellulose synthase-like A1; Pinus taeda (Loblolly pine). | - | - | 0.0 | 43% |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Transferases, Glycosyltransferases, Hexosyltransferases. | EC:2.4.1.- | - | 4.878e-17 | - |
Source | Gene names |
---|---|
Sma3 | At2g24630; At4g07960; At4g31590; CSLC1; CSLC10; CSLC12; CSLC5; CSLC7; CSLC8; CSLC9; CslC1; CslC3; F1K3.3; F25P17.7; F28M20.220; GSVIVT00000743001; GSVIVT00012530001; GSVIVT00014999001; GSVIVT00025276001; LOC_Os01g56130; LOC_Os03g56060; LOC_Os05g43530; OJ1 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Golgi membrane | GO:0000139 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | transferase activity | GO:0016740 | Molecular Function | 0.0 | - |
Sma3 | transferase activity, transferring glycosyl groups | GO:0016757 | Molecular Function | 0.0 | - |
Sma3 | cellular cell wall organization | GO:0007047 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Glycosyl transferase, family 2 | IPR001173 | - | 0.0 | - |
Sma3 | Inorganic pyrophosphatase | IPR008162 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT2G24630.1 | ATCSLC08, CSLC08, ATCSLC8 Glycosyl transferase family 2 protein chr2:10471558-10473984 REVERSE LENGTH=690 | 1.0e-17 | 72% |
RefSeq | Arabidopsis thaliana | NP_180039.1 | putative xyloglucan glycosyltransferase 8 [Arabidopsis thaliana] | 1.0e-17 | 72% |
RefSeq | Populus trichocarpa | XP_002334106.1 | predicted protein [Populus trichocarpa] | 5.0e-18 | 68% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A3QT94
Fln msg: Separated hits, possible frame ERROR between 190 and 192, Distance to subject end: 357 aas, your sequence is shorter than subject: 82 - 530
Fln protein:
S
Protein Length:
83
Fln nts:
A
Fln Alignment:
GD4IA4403GQRUW___YTVMQVYQQSIAAVCNLDWPKDHMLVQVLDDSDDVEVQFLIAAEVTKMATExGVHIVYRHRVVRTGYKAG
A3QT94_______________YNEKEVYQLSIGAACGLSWPSDRIIIQVLDDSTDPAIKELVTMECQRWASKxGINIKYEIRDNRNGYKAG
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain