UniGene Name: sp_v3.0_unigene78745
Length: 110 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene78745
T |
Ace file of the UniGene sp_v3.0_unigene78745 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Peptidase S8 and S53, subtilisin, kexin, sedolisin [Medicago truncatula] | - | - | 1.0e-09 | 83% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 77% |
| Sma3 | Subtilisin-like protease | - | - | 2.905e-32 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | 2-alkenal reductase. | EC:1.3.1.74 | - | 4.896e-07 | - |
| Sma3 | Cucumisin. | EC:3.4.21.25 | - | 7.309e-22 | - |
| Source | Gene names |
|---|---|
| Sma3 | A43; AIR3; ARA12; ASP48; AT4g34980; At1g20160; At2g04160; At2g05920; At4g34980; At5g59090; At5g59120; At5g59810/mmn10_30; At5g67360; GSVIVT00001075001; GSVIVT00004225001; GSVIVT00004227001; GSVIVT00004387001; GSVIVT00007214001; GSVIVT00008202001; GSVIVT00 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | plant-type cell wall | GO:0009505 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
| Sma3 | serine-type endopeptidase activity | GO:0004252 | Molecular Function | 0.0 | - |
| Sma3 | calcium ion binding | GO:0005509 | Molecular Function | 0.0 | - |
| Sma3 | identical protein binding | GO:0042802 | Molecular Function | 0.0 | - |
| Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
| Sma3 | response to auxin stimulus | GO:0009733 | Biological Process | 0.0 | - |
| Sma3 | plant-type cell wall modification | GO:0009827 | Biological Process | 0.0 | - |
| Sma3 | lateral root morphogenesis | GO:0010102 | Biological Process | 0.0 | - |
| Sma3 | negative regulation of catalytic activity | GO:0043086 | Biological Process | 0.0 | - |
| Sma3 | mucilage metabolic process involved seed coat development | GO:0048359 | Biological Process | 0.0 | - |
| Sma3 | mucilage extrusion from seed coat | GO:0080001 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | C2 calcium-dependent membrane targeting | IPR000008 | - | 0.0 | - |
| Sma3 | Ornithine/DAP/Arg decarboxylase | IPR000183 | - | 0.0 | - |
| Sma3 | Peptidase S8/S53, subtilisin/kexin/sedolisin | IPR000209 | - | 0.0 | - |
| Sma3 | RNA helicase, ATP-dependent, DEAD-box, conserved site | IPR000629 | - | 0.0 | - |
| Sma3 | Arf GTPase activating protein | IPR001164 | - | 0.0 | - |
| Sma3 | Protease-associated domain, PA | IPR003137 | - | 0.0 | - |
| Sma3 | Domain of unknown function DUF591 | IPR007649 | - | 0.0 | - |
| Sma3 | Proteinase inhibitor I9 | IPR010259 | - | 0.0 | - |
| Sma3 | Reverse transcriptase, RNA-dependent DNA polymerase | IPR013103 | - | 0.0 | - |
| Sma3 | Peptidase S8, subtilisin-related | IPR015500 | - | 0.0 | - |
| Sma3 | C2 membrane targeting protein | IPR018029 | - | 0.0 | - |
| Sma3 | Chromogranin, conserved site | IPR018054 | - | 0.0 | - |
| Sma3 | Peroxidases heam-ligand binding site | IPR019793 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G59810.1 | ATSBT5.4, SBT5.4 Subtilase family protein chr5:24096895-24100387 REVERSE LENGTH=778 | 9.0e-14 | 83% |
| RefSeq | Arabidopsis thaliana | NP_200789.2 | Subtilase family protein [Arabidopsis thaliana] | 1.0e-13 | 83% |
| RefSeq | Populus trichocarpa | XP_002339414.1 | predicted protein, partial [Populus trichocarpa] | 1.0e-13 | 88% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5AE86
Fln msg: Distance to subject end: 251 aas, your sequence is shorter than subject: 36 - 394
Fln protein:
K
Protein Length:
37
Fln nts:
T
Fln Alignment:
GD4IA4403F5PBD___KPAPVMAKFSSQGPNQITPDILKPDITAPGVNILA
D5AE86_______________KPAPVVASFSSRGPNPETPEILKPDVIAPGVNILA

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta (sense)