UniGene Name: sp_v3.0_unigene78701
Length: 188 nt
UniGene Fasta |
---|
>sp_v3.0_unigene78701
A |
Ace file of the UniGene sp_v3.0_unigene78701 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Cu2+-exporting ATPase [Arabidopsis thaliana] sp|Q9SH30.2|AHM7_ARATH RecName: Full=Putative copper-transporting ATPase 3 gb|ACF95837.1| heavy metal P-type ATPase [Arabidopsis thaliana] gb|ACF95838.1| heavy metal P-type ATPase [Arabidopsis thaliana] gb|ACF9 | - | - | 3.0e-18 | 72% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 58% |
Sma3 | Heavy metal ATPase | - | - | 5.893e-16 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Copper-exporting ATPase. | EC:3.6.3.4 | - | 5.585e-09 | - |
Source | Gene names |
---|---|
Sma3 | At1g63440; F2K11.18; GSVIVT00000399001; GSVIVT00000403001; GSVIVT00000405001; GSVIVT00024633001; HMA5; OJ1225_F07.30; OJ1524_D08.15; OSJNBb0012E24.8; Os02g0196600; Os04g0556000; OsI_06234; OsI_16937; OsJ_05752; OsJ_15734; PHYPADRAFT_165109; PHYPADRAFT_192 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | magnesium ion binding | GO:0000287 | Molecular Function | 0.0 | - |
Sma3 | copper-exporting ATPase activity | GO:0004008 | Molecular Function | 0.0 | - |
Sma3 | copper ion binding | GO:0005507 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | metal ion binding | GO:0046872 | Molecular Function | 0.0 | - |
Sma3 | ATP biosynthetic process | GO:0006754 | Biological Process | 0.0 | - |
Sma3 | copper ion transport | GO:0006825 | Biological Process | 0.0 | - |
Sma3 | detoxification of copper ion | GO:0010273 | Biological Process | 0.0 | - |
Sma3 | metal ion transport | GO:0030001 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Flagellar motor protein MotA, conserved site | IPR000540 | - | 0.0 | - |
Sma3 | ATPase, P-type, H+ transporting proton pump | IPR000695 | - | 0.0 | - |
Sma3 | IPR001756 | - | 0.0 | - | |
Sma3 | ATPase, P-type, K/Mg/Cd/Cu/Zn/Na/Ca/Na/H-transporter | IPR001757 | - | 0.0 | - |
Sma3 | IPR001877 | - | 0.0 | - | |
Sma3 | Haloacid dehalogenase-like hydrolase | IPR005834 | - | 0.0 | - |
Sma3 | Heavy metal-associated domain, HMA | IPR006121 | - | 0.0 | - |
Sma3 | Heavy metal-associated domain, copper ion-binding | IPR006122 | - | 0.0 | - |
Sma3 | ATPase, P type, cation/copper-transporter | IPR006403 | - | 0.0 | - |
Sma3 | ATPase, P-type, heavy metal translocating | IPR006416 | - | 0.0 | - |
Sma3 | ATPase, P-type, ATPase-associated domain | IPR008250 | - | 0.0 | - |
Sma3 | Beta tubulin, autoregulation binding site | IPR013838 | - | 0.0 | - |
Sma3 | Heavy-metal-associated, conserved site | IPR017969 | - | 0.0 | - |
Sma3 | ATPase, P-type phosphorylation site | IPR018303 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G63440.1 | HMA5 heavy metal atpase 5 chr1:23527655-23531109 FORWARD LENGTH=995 | 2.0e-23 | 72% |
RefSeq | Arabidopsis thaliana | NP_176533.1 | Cu2+-exporting ATPase [Arabidopsis thaliana] | 2.0e-23 | 72% |
RefSeq | Populus trichocarpa | XP_002299234.1 | heavy metal ATPase [Populus trichocarpa] | 5.0e-26 | 77% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LQ20
Fln msg: Distance to subject end: 490 aas, your sequence is shorter than subject: 62 - 998
Fln protein:
D
Protein Length:
63
Fln nts:
A
Fln Alignment:
GD4IA4403G06PH___DGNVTSEMEISSQLIQRNDIIRVVPGAKVPTDGIVIRGQSHVNESMITGEARPVAKRSGDKV
B8LQ20_______________DGKHVEEKEIDAQLIQRSDMLKVYPGSKVPADGTVVWGSSHVNESMITGESALVSKEVGGTV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain