SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene78676

Length: 248 nt

UniGene Fasta

>sp_v3.0_unigene78676
GCACCAGCGGTTTCTGATATACGATTACATGCCCAATGGAACTCTCGATGACCACATCTTTGGAGCAAAATCAACGGCCAGATCTTTGAGCTGGCAACAGCGCCGGAATATCATCCTGGGCACAGCGAAGGGGCTGGCTTATCTGCATAACGGTATTGAGCCGGCGATTTATCACAGAGACATCAAAGCGAACAACATTCTGCTAGATGACGATATGAATGCCCGTGTAGCCGATTTTGGGTTGGCGA

Ace file of the UniGene sp_v3.0_unigene78676

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Kinase, putative n=1 Tax=Ricinus communis RepID=B9SU72_RICCO	-	-	1.0e-25	66%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	79%
Sma3	Kinase, putative	-	-	1.026e-11	-

Source	ECs	Term	Type	e value	Identity
Sma3	Non-specific protein-tyrosine kinase.	EC:2.7.10.2	-	1.804e-08	-
Sma3		EC:2.7.11.3-	-	3.594e-09	-

Source	Gene names
Sma3	AT4g00340; AT4g01330; AT4g02630; AT4g34500; AT5G48740; A_IG002N01.22; A_IG005I10.19; At1g01540; At1g11050; At1g49270; At2g39180; At2g42960; At2g48010; At3g59110; At4g02630; At4g34500; At5g02070; At5g06740; At5g40380; At5g59260; B0222C05.2; B1065E10.29; CL

Source	GOs	Term	Type	Identity
Sma3	nucleus	GO:0005634	Cellular Component	-
Sma3	plasma membrane	GO:0005886	Cellular Component	-
Sma3	integral to membrane	GO:0016021	Cellular Component	-
Sma3	nucleic acid binding	GO:0003676	Molecular Function	-
Sma3	sequence-specific DNA binding transcription factor activity	GO:0003700	Molecular Function	-
Sma3	peptidyl-prolyl cis-trans isomerase activity	GO:0003755	Molecular Function	-
Sma3	DNA-directed RNA polymerase activity	GO:0003899	Molecular Function	-
Sma3	protein serine/threonine kinase activity	GO:0004674	Molecular Function	-
Sma3	protein tyrosine kinase activity	GO:0004713	Molecular Function	-
Sma3	receptor activity	GO:0004872	Molecular Function	-
Sma3	protein binding	GO:0005515	Molecular Function	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	sugar binding	GO:0005529	Molecular Function	-
Sma3	sequence-specific DNA binding	GO:0043565	Molecular Function	-
Sma3		GO:0006350	Biological Process	-
Sma3	regulation of transcription, DNA-dependent	GO:0006355	Biological Process	-
Sma3	protein folding	GO:0006457	Biological Process	-
Sma3	protein phosphorylation	GO:0006468	Biological Process	-
Sma3	recognition of pollen	GO:0048544	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Protein kinase, catalytic domain	IPR000719	-	-
Sma3	S-locus glycoprotein	IPR000858	-	-
Sma3	Peptidyl-prolyl cis-trans isomerase, FKBP-type, domain	IPR001179	-	-
Sma3	Legume lectin domain	IPR001220	-	-
Sma3	Serine-threonine/tyrosine-protein kinase catalytic domain	IPR001245	-	-
Sma3	TNFR/CD27/30/40/95 cysteine-rich region	IPR001368	-	-
Sma3	Aminoacyl-tRNA synthetase, class I, conserved site	IPR001412	-	-
Sma3	Bulb-type lectin domain	IPR001480	-	-
Sma3	Leucine-rich repeat	IPR001611	-	-
Sma3	Transcription factor, MADS-box	IPR002100	-	-
Sma3	Serine/threonine- / dual-specificity protein kinase, catalytic domain	IPR002290	-	-
Sma3	Gnk2-homologous domain	IPR002902	-	-
Sma3	PAN-1 domain	IPR003014	-	-
Sma3	Argonaute/Dicer protein, PAZ	IPR003100	-	-
Sma3	Stem cell self-renewal protein Piwi	IPR003165	-	-
Sma3	Apple-like	IPR003609	-	-
Sma3	RNA polymerase Rpb7, N-terminal	IPR005576	-	-
Sma3	Serine/threonine-protein kinase, active site	IPR008271	-	-
Sma3	Regulator of chromosome condensation/beta-lactamase-inhibitor protein II	IPR009091	-	-
Sma3	Nucleic acid-binding, OB-fold	IPR012340	-	-
Sma3	EGF-like region, conserved site	IPR013032	-	-
Sma3	Leucine-rich repeat-containing N-terminal, type 2	IPR013210	-	-
Sma3	PAN-2 domain	IPR013227	-	-
Sma3	Concanavalin A-like lectin/glucanase, subgroup	IPR013320	-	-
Sma3	Domain of unknown function DUF1785	IPR014811	-	-
Sma3	Protein kinase, ATP binding site	IPR017441	-	-
Sma3		IPR017442	-	-
Sma3	Beta-ketoacyl synthase, active site	IPR018201	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT1G11050.1	Protein kinase superfamily protein chr1:3681892-3683769 FORWARD LENGTH=625	4.0e-32	69%
RefSeq	Arabidopsis thaliana	NP_172572.1	putative receptor-like protein kinase [Arabidopsis thaliana]	5.0e-32	69%
RefSeq	Populus trichocarpa	XP_002305887.1	predicted protein [Populus trichocarpa]	3.0e-31	66%

Full-Lengther Next Prediction

Fln status: N-terminus

Fln database: coniferopsida.fasta

Fln subject: D5ACH5

Fln msg: Distance to subject end: 173 aas, your sequence is shorter than subject: 73 - 246

Fln protein: MPNGTLDDHIFGAKSTARSLSWQQRRNIILGTAKGLAYLHNGIEPAIYHRDIKANNILLDDDMNARVADFGLA

Protein Length: 74

Fln nts: GCACCAGCGGTTTCTGATATACGATTAC_-_ATGCCCAATGGAACTCTCGATGACCACATCTTTGGAGCAAAATCAACGGCCAGATCTTTGAGCTGGCAACAGCGCCGGAATATCATCCTGGGCACAGCGAAGGGGCTGGCTTATCTGCATAACGGTATTGAGCCGGCGATTTATCACAGAGACATCAAAGCGAACAACATTCTGCTAGATGACGATATGAATGCCCGTGTAGCCGATTTTGGGTTGGCGA

Fln Alignment:

GD4IA4403GRLIX___MPNGTLDDHIFGAKSTARSLSWQQRRNIILGTAKGLAYLHNGIEPAIYHRDIKANNILLDDDMNARVADFGLA
D5ACH5_______________MPNGSLDDHIFGLKSKAQPLSWPQRRKIVMGTAKGLAYLHDGIQPAIYHRDIKPTNILLDDEMNAFVADFGLA

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain