|
||||||
|
UniGene Name: sp_v3.0_unigene78644
Length: 238 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene78644
C |
|
Ace file of the UniGene sp_v3.0_unigene78644
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Leucine Rich Repeat family protein n=3 Tax=Oryza sativa RepID=Q7XDK0_ORYSJ | - | - | 5.0e-17 | 58% |
| FL-Next | tr=Uncharacterized protein; Cryptomeria japonica (Japanese cedar) (Cupressus japonica). | - | - | 0.0 | 41% |
| Sma3 | Leucine Rich Repeat family protein | - | - | 1.91e-07 | - |
| Source | Gene names |
|---|---|
| Sma3 | AT4G08850; AT4g08850; At2g15040; At4g08850; Cf-5; GSVIVT00009161001; GSVIVT00017827001; GSVIVT00017828001; GSVIVT00035501001; Hcr2-5D; LOC_Os10g33040; LOC_Os10g33080; LOC_Os10g33110; LOC_Os10g33130; LRR-RLK; OJ1626_B09.14; OSJNBa0006L06.21; OSJNBa0079L16. |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
| Sma3 | Serine-threonine/tyrosine-protein kinase catalytic domain | IPR001245 | - | 0.0 | - |
| Sma3 | Leucine-rich repeat | IPR001611 | - | 0.0 | - |
| Sma3 | Guanine-nucleotide dissociation stimulator CDC25 | IPR001895 | - | 0.0 | - |
| Sma3 | Leucine-rich repeat, typical subtype | IPR003591 | - | 0.0 | - |
| Sma3 | Tyrosine-protein kinase, active site | IPR008266 | - | 0.0 | - |
| Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
| Sma3 | Leucine-rich repeat-containing N-terminal, type 2 | IPR013210 | - | 0.0 | - |
| Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
| Sma3 | IPR017442 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G08850.1 | Leucine-rich repeat receptor-like protein kinase family protein chr4:5636693-5640496 REVERSE LENGTH=1045 | 2.0e-19 | 55% |
| RefSeq | Arabidopsis thaliana | NP_192625.4 | Leucine-rich repeat-containing protein [Arabidopsis thaliana] | 3.0e-19 | 55% |
| RefSeq | Populus trichocarpa | XP_002322384.1 | predicted protein [Populus trichocarpa] | 5.0e-20 | 54% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: I4DUG2
Fln msg: Distance to subject end: 160 aas, your sequence is shorter than subject: 79 - 743
Fln protein:
L
Protein Length:
80
Fln nts:
C
Fln Alignment:
GD4IA4403FVDVQ___LSSYRNLVSLYLCFNNLSGTIPGELGSLSHLQELNLGANSLTGTIP----SSLGNLSLLIRLGMFENSLVGLIPPQLG
I4DUG2_______________LCSPQQLRYIYLQHNNLSEEIPVSLEGCQKLELLDFSYNNLGGTIPRGFIASLKNLQLYLNLS--SNSLQGFLPQEMG
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
