UniGene Name: sp_v3.0_unigene78618
Length: 129 nt
![]() |
---|
>sp_v3.0_unigene78618
G |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | putative receptor ser/thr protein [Oryza sativa Japonica Group] gb|ABF95119.1| Protein kinase domain containing protein, expressed [Oryza sativa Japonica Group] | - | - | 2.0e-07 | 70% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 80% |
Sma3 | ATP binding protein, putative | - | - | 9.246e-08 | - |
Source | Gene names |
---|---|
Sma3 | AT1G07650; AT1G29720; AT1G29750; At1g11050; At1g29720; At1g29750; At5g40380; B1065E10.29; CRK42; F1N18.19; F1N18.22; F24B9.29; GSVIVT00020696001; GSVIVT00021495001; GSVIVT00023188001; GSVIVT00024124001; GSVIVT00026477001; GSVIVT00026479001; GSVIVT00027888 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G09010.1 | Protein kinase superfamily protein chr3:2750285-2752086 FORWARD LENGTH=393 | 2.0e-11 | 67% |
RefSeq | Arabidopsis thaliana | NP_566341.1 | protein kinase domain-containing protein [Arabidopsis thaliana] | 2.0e-11 | 67% |
RefSeq | Populus trichocarpa | XP_002305688.1 | predicted protein, partial [Populus trichocarpa] | 2.0e-11 | 72% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: C0PPW7
Fln msg: Distance to subject end: 140 aas, your sequence is shorter than subject: 43 - 702
Fln protein:
D
Protein Length:
44
Fln nts:
G
Fln Alignment:
GD4IA4403GZRNJ___ISLYMALCSGYMAPEYALCGQLTEKADVFSFGVLVLEIIS
C0PPW7_______________VSTRVAGTLGYMAPEYALRGQLTEKADVFSFGVLVLEIIS
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain