UniGene Name: sp_v3.0_unigene78614
Length: 248 nt
UniGene Fasta |
---|
>sp_v3.0_unigene78614
T |
Ace file of the UniGene sp_v3.0_unigene78614 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] sp|Q9LNU6.2|PPR53_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g20230 gb|AEE29953.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] | - | - | 2.0e-18 | 53% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 70% |
Sma3 | Pentatricopeptide repeat-containing protein, putative | - | - | 2.257e-16 | - |
Source | Gene names |
---|---|
Sma3 | At1g11290; At1g20230; At4g18750; F28A21.160; GSVIVT00001706001; GSVIVT00002068001; GSVIVT00003648001; GSVIVT00007631001; GSVIVT00014353001; GSVIVT00019097001; GSVIVT00022590001; GSVIVT00023425001; GSVIVT00024231001; GSVIVT00026234001; GSVIVT00034189001; G |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | diacylglycerol kinase activity | GO:0004143 | Molecular Function | 0.0 | - |
Sma3 | endonuclease activity | GO:0004519 | Molecular Function | 0.0 | - |
Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
Sma3 | hydrolase activity, acting on ester bonds | GO:0016788 | Molecular Function | 0.0 | - |
Sma3 | lipid metabolic process | GO:0006629 | Biological Process | 0.0 | - |
Sma3 | activation of protein kinase C activity by G-protein coupled receptor protein signaling pathway | GO:0007205 | Biological Process | 0.0 | - |
Sma3 | phloem or xylem histogenesis | GO:0010087 | Biological Process | 0.0 | - |
Sma3 | leaf vascular tissue pattern formation | GO:0010305 | Biological Process | 0.0 | - |
Sma3 | cotyledon vascular tissue pattern formation | GO:0010588 | Biological Process | 0.0 | - |
Sma3 | mRNA modification | GO:0016556 | Biological Process | 0.0 | - |
Sma3 | leaf development | GO:0048366 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Ribonuclease P | IPR000100 | - | 0.0 | - |
Sma3 | Diacylglycerol kinase, accessory domain | IPR000756 | - | 0.0 | - |
Sma3 | Beta-lactamase, class-A/D | IPR000871 | - | 0.0 | - |
Sma3 | Lipase, GDSL | IPR001087 | - | 0.0 | - |
Sma3 | Diacylglycerol kinase, catalytic domain | IPR001206 | - | 0.0 | - |
Sma3 | Pentatricopeptide repeat | IPR002885 | - | 0.0 | - |
Sma3 | Zinc finger-XS domain | IPR005381 | - | 0.0 | - |
Sma3 | TonB box, conserved site | IPR010916 | - | 0.0 | - |
Sma3 | Tetratricopeptide-like helical | IPR011990 | - | 0.0 | - |
Sma3 | Asp/Glu racemase, active site | IPR018187 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G20230.1 | Pentatricopeptide repeat (PPR) superfamily protein chr1:7009570-7011852 FORWARD LENGTH=760 | 2.0e-23 | 53% |
RefSeq | Arabidopsis thaliana | NP_173449.1 | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] | 2.0e-23 | 53% |
RefSeq | Populus trichocarpa | XP_002301973.1 | predicted protein [Populus trichocarpa] | 2.0e-24 | 53% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LQA8
Fln msg: Distance to subject end: 323 aas, your sequence is shorter than subject: 82 - 795
Fln protein:
S
Protein Length:
83
Fln nts:
T
Fln Alignment:
GD4IA4403HA0RI___SWNAIIGGYCQNGHPLEALTFFSEMQVEGLKPNLITIVGVLPACANLLALEQGKQIHGYAIRNGFDSDVVVGTVLVDMYAKC
B8LQA8_______________AWNAIISGYSQHGHPHEALALFIEMQAQGIKPDSFAIVSVLPACAHFLALEQGKQIHGYTIRSGFESNVVVGTGLVDIYAKC
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain