UniGene Name: sp_v3.0_unigene78513
Length: 151 nt
UniGene Fasta |
---|
>sp_v3.0_unigene78513
A |
Ace file of the UniGene sp_v3.0_unigene78513 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Receptor-like protein kinase n=1 Tax=Glycine max RepID=C6ZS18_SOYBN | - | - | 3.0e-15 | 79% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 63% |
Sma3 | Putative S-receptor kinase KIK1 | - | - | 1.185e-07 | - |
Source | Gene names |
---|---|
Sma3 | AT4g21390; AT4g27300; At4g21390; At4g27300; B1070A12.1; B1070A12.4; B1100D10.44; B120; BRLK; F14G9.24; F18E5.10; GSVIVT00002759001; GSVIVT00006137001; GSVIVT00010699001; GSVIVT00010987001; GSVIVT00010990001; GSVIVT00016852001; GSVIVT00020409001; GSVIVT000 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | sugar binding | GO:0005529 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | recognition of pollen | GO:0048544 | Biological Process | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G21390.1 | B120 S-locus lectin protein kinase family protein chr4:11394458-11397474 REVERSE LENGTH=849 | 6.0e-15 | 65% |
RefSeq | Arabidopsis thaliana | NP_193870.1 | S-locus lectin protein kinase-like protein [Arabidopsis thaliana] | 7.0e-15 | 65% |
RefSeq | Populus trichocarpa | XP_002327462.1 | predicted protein, partial [Populus trichocarpa] | 1.0e-19 | 80% |
Full-Lengther Next Prediction |
---|
Fln status: Putative N-terminus
Fln database: coniferopsida.fasta
Fln subject: A9NQB9
Fln msg: Distance to subject end: 237 aas, atg_distance in limit (1-15): atg_distance = 4, W2: There is no M at the beginning, your sequence is shorter than subject: 49 - 290
Fln protein:
V
Protein Length:
50
Fln nts:
A
Fln Alignment:
GD4IA4403GCKJN___VKLISNVHHRNLVRLLGCCNQGPERLLVYEYMPNSSLDRVLFGEGRQSL
A9NQB9_______________VKLVAKIQHRNLVQLLGCCVDGPERLLVYEYLPNKSLDKLLFNPERRKV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain