UniGene Name: sp_v3.0_unigene78491
Length: 142 nt
UniGene Fasta |
---|
>sp_v3.0_unigene78491
A |
Ace file of the UniGene sp_v3.0_unigene78491 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Laccase n=2 Tax=Pinus taeda RepID=Q9AUI3_PINTA | - | - | 1.0e-18 | 90% |
FL-Next | tr=Laccase; Pinus taeda (Loblolly pine). | - | - | 0.0 | 90% |
Sma3 | Laccase, putative | - | - | 1.049e-31 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Laccase. | EC:1.10.3.2 | - | 9.52603e-41 | - |
Sma3 | L-ascorbate oxidase. | EC:1.10.3.3 | - | 8.455e-28 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Ascorbate and aldarate metabolism | 00053 | 8.455e-28 | % | |
Sma3 | Metabolic pathways | 01100 | 8.455e-28 | % |
Source | Gene names |
---|---|
Sma3 | At2g38080; At2g40370; At5g05390; At5g09360; At5g48100; At5g58910; B1026C12.14; B1045D11.30; B1088C09.5; F16M14.1; GLac90; GSVIVT00006357001; GSVIVT00006373001; GSVIVT00008749001; GSVIVT00010239001; GSVIVT00018427001; GSVIVT00018428001; GSVIVT00018452001; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
Sma3 | copper ion binding | GO:0005507 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | laccase activity | GO:0008471 | Molecular Function | 0.0 | - |
Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
Sma3 | lignin biosynthetic process | GO:0009809 | Biological Process | 0.0 | - |
Sma3 | secondary cell wall biogenesis | GO:0009834 | Biological Process | 0.0 | - |
Sma3 | lignin catabolic process | GO:0046274 | Biological Process | 0.0 | - |
Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Peptidase, cysteine peptidase active site | IPR000169 | - | 0.0 | - |
Sma3 | Multicopper oxidase, type 1 | IPR001117 | - | 0.0 | - |
Sma3 | Leucine-rich repeat | IPR001611 | - | 0.0 | - |
Sma3 | Multicopper oxidase, copper-binding site | IPR002355 | - | 0.0 | - |
Sma3 | Leucine-rich repeat, typical subtype | IPR003591 | - | 0.0 | - |
Sma3 | Cupredoxin | IPR008972 | - | 0.0 | - |
Sma3 | Multicopper oxidase, type 2 | IPR011706 | - | 0.0 | - |
Sma3 | Multicopper oxidase, type 3 | IPR011707 | - | 0.0 | - |
Sma3 | Laccase | IPR017761 | - | 0.0 | - |
Sma3 | Glycoside hydrolase, family 1, active site | IPR018120 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT2G40370.1 | LAC5 laccase 5 chr2:16858192-16860593 REVERSE LENGTH=580 | 5.0e-21 | 79% |
RefSeq | Arabidopsis thaliana | NP_181568.1 | laccase 5 [Arabidopsis thaliana] | 7.0e-21 | 79% |
RefSeq | Populus trichocarpa | XP_002315131.1 | laccase 90c [Populus trichocarpa] | 1.0e-21 | 77% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: Q9AUI3
Fln msg: Distance to subject end: 459 aas, your sequence is shorter than subject: 46 - 570
Fln protein:
A
Protein Length:
47
Fln nts:
A
Fln Alignment:
GD4IA4403FZI6O___RNGDTLIVKVYNKAQYNATIHWHGVHQFRTGWSDGPEFITQCPI
Q9AUI3_______________RNGDTLVVKVYNNAQYNATIHWHGVRQFRTGWSDGPEYITQCPI
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain