UniGene Name: sp_v3.0_unigene78482
Length: 196 nt
![]() |
---|
>sp_v3.0_unigene78482
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | RecName: Full=Pleiotropic drug resistance protein 12 dbj|BAD53545.1| PDR-like ABC transporter [Oryza sativa Japonica Group] gb|EEE65874.1| hypothetical protein OsJ_21675 [Oryza sativa Japonica Group] | - | - | 4.0e-18 | 61% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 87% |
Sma3 | ATP-binding cassette transporter, putative | - | - | 9.554e-09 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Heme-transporting ATPase. | EC:3.6.3.41 | - | 1.785e-07 | - |
Source | Gene names |
---|---|
Sma3 | At1g59870; At3g16340; F23H11.19; LOC_Os06g36090; MYA6.14; Os06g0554800; OsI_23352; OsJ_21675; P0458E11.3-1; P0458E11.3-2; PDR1; PDR12; PDR8; PHYPADRAFT_175287; PHYPADRAFT_192434; POPTRDRAFT_705805; RCOM_0471640; RCOM_1016560; RCOM_1441940; T02O04.17; ppab |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | cadmium ion transmembrane transporter activity | GO:0015086 | Molecular Function | 0.0 | - |
Sma3 | ATPase activity | GO:0016887 | Molecular Function | 0.0 | - |
Sma3 | transport | GO:0006810 | Biological Process | 0.0 | - |
Sma3 | systemic acquired resistance | GO:0009627 | Biological Process | 0.0 | - |
Sma3 | defense response to fungus, incompatible interaction | GO:0009817 | Biological Process | 0.0 | - |
Sma3 | cadmium ion transport | GO:0015691 | Biological Process | 0.0 | - |
Sma3 | negative regulation of defense response | GO:0031348 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | ABC transporter-like | IPR003439 | - | 0.0 | - |
Sma3 | AAA+ ATPase domain | IPR003593 | - | 0.0 | - |
Sma3 | Pleiotropic drug resistance protein PDR | IPR005285 | - | 0.0 | - |
Sma3 | ABC-2 type transporter | IPR013525 | - | 0.0 | - |
Sma3 | Plant PDR ABC transporter associated | IPR013581 | - | 0.0 | - |
Sma3 | ABC transporter, conserved site | IPR017871 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G16340.1 | ATPDR1, PDR1 pleiotropic drug resistance 1 chr3:5539897-5546263 FORWARD LENGTH=1416 | 2.0e-22 | 60% |
RefSeq | Arabidopsis thaliana | NP_001189911.1 | ABC transporter G family member 29 [Arabidopsis thaliana] | 3.0e-22 | 60% |
RefSeq | Populus trichocarpa | XP_002298240.1 | ABC transporter family, pleiotropic drug resistance protein [Populus trichocarpa] | 1.0e-21 | 56% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NW55
Fln msg: Distance to subject end: 90 aas, your sequence is shorter than subject: 65 - 471
Fln protein:
Y
Protein Length:
66
Fln nts:
A
Fln Alignment:
GD4IA4403FNN7H___YSVMGFHWSVYKFFWYLFVTLCNFLCFTYYGMLTVAISPNAQLAAVIASGFYSIFNLFSGFSITR
A9NW55_______________YSVIGFHWSVDKFFWYLFVTLCHFLYFTYYGMLTVAISPNAQVAAVISSAFYSIFNLFSGFLITR
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain