UniGene Name: sp_v3.0_unigene78480
Length: 223 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene78480
C |
Ace file of the UniGene sp_v3.0_unigene78480 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Phenylalanine ammonia-lyase (Fragment) n=1 Tax=Pellia epiphylla RepID=Q5EP57_9MARC | - | - | 2.0e-25 | 86% |
| FL-Next | sp=Phenylalanine ammonia-lyase; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 94% |
| Sma3 | Phenylalanine ammonia-lyase | - | - | 0.0 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Phenylalanine ammonia-lyase. | EC:4.3.1.24 | - | 0.0 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Phenylalanine metabolism | 00360 | 0.0 | % | |
| Sma3 | Nitrogen metabolism | 00910 | 0.0 | % | |
| Sma3 | Phenylpropanoid biosynthesis | 00940 | 0.0 | % | |
| Sma3 | Biosynthesis of phenylpropanoids | 01061 | 0.0 | % | |
| Sma3 | Biosynthesis of alkaloids derived from shikimate pathway | 01063 | 0.0 | % | |
| Sma3 | Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid | 01064 | 0.0 | % | |
| Sma3 | Biosynthesis of plant hormones | 01070 | 0.0 | % | |
| Sma3 | Metabolic pathways | 01100 | 0.0 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 0.0 | % | |
| Sma3 | Transferred entry: 4.3.1.23, 4.3.1.24 and 4.3.1.25. | EC:4.3.1.5 | - | 1.608e-09 | - |
| Source | Gene names |
|---|---|
| Sma3 | AT3G53260; At2g37040; At3g10340; At5g04230; B1215B07.42; BoPAL; DcPAL4; Espal1; Espal2; Espal3; Espal4; F14P13.6; F21E1_150; GSVIVT00013922001; GSVIVT00013924001; GSVIVT00013927001; GSVIVT00013928001; GSVIVT00013930001; GSVIVT00013936001; GSVIVT0001393900 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | ammonia ligase activity | GO:0016211 | Molecular Function | 0.0 | - |
| Sma3 | lyase activity | GO:0016829 | Molecular Function | 0.0 | - |
| Sma3 | ammonia-lyase activity | GO:0016841 | Molecular Function | 0.0 | - |
| Sma3 | phenylalanine ammonia-lyase activity | GO:0045548 | Molecular Function | 0.0 | - |
| Sma3 | L-phenylalanine catabolic process | GO:0006559 | Biological Process | 0.0 | - |
| Sma3 | biosynthetic process | GO:0009058 | Biological Process | 0.0 | - |
| Sma3 | phenylpropanoid metabolic process | GO:0009698 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Aromatic amino acid lyase | IPR001106 | - | 0.0 | - |
| Sma3 | Phenylalanine ammonia-lyase | IPR005922 | - | 0.0 | - |
| Sma3 | Phosphopantetheine attachment site | IPR006162 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G10340.1 | PAL4 phenylalanine ammonia-lyase 4 chr3:3204260-3207809 FORWARD LENGTH=707 | 1.0e-24 | 68% |
| RefSeq | Arabidopsis thaliana | NP_187645.1 | phenylalanine ammonia-lyase 4 [Arabidopsis thaliana] | 2.0e-24 | 68% |
| RefSeq | Populus trichocarpa | XP_002326186.1 | phenylalanine amonnia lyase [Populus trichocarpa] | 5.0e-23 | 64% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NVP8
Fln msg: ERROR#3, very serious frame error, Overlapping hits, possible frame ERROR between 150 and 147, Distance to subject end: 302 aas, your sequence is shorter than subject: 74 - 720
Fln protein:
H
Protein Length:
75
Fln nts:
C
Fln Alignment:
GD4IA4403FNDE5___HEMNPLQKPKQDRYALRTSPQWLGPQIEVIRSATHMIQREINSVNDNPVMDVARDKALHGGNFQGTPIGVSNRN
A9NVP8_______________HEMNPLQKPKQDRYALRTSPQWLGPQAEVIRSATHMIEREINSVNDNPVIDVARDLALHGGNFQGTPIGVSMDN

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta (sense)