|
||||||
|
UniGene Name: sp_v3.0_unigene78477
Length: 172 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene78477
G |
|
Ace file of the UniGene sp_v3.0_unigene78477
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | MYC transcription factor [Solanum tuberosum] | - | - | 8.0e-09 | 66% |
| FL-Next | tr=JAMYC; Taxus cuspidata (Japanese yew). | - | - | 0.0 | 62% |
| Source | Gene names |
|---|---|
| Sma3 | 23.t00048; ATR2; At1g32640; At4g17880; At5g46760; BHLH4; BHLH5; BHLH6; EN36; EN37; EN38; F6N18.4; GBF; JAI1; JAMYC; JIN1; LEJA3; MYC2; MYC4; MZA15.18; PG1; POPTRDRAFT_676550; POPTRDRAFT_836925; RAP1; RCOM_0864470; RD22BP1; T6K21.60; ZBF1; jamyc2; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | transcription activator activity | GO:0016563 | Molecular Function | 0.0 | - |
| Sma3 | transcription regulator activity | GO:0030528 | Molecular Function | 0.0 | - |
| Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
| Sma3 | defense response | GO:0006952 | Biological Process | 0.0 | - |
| Sma3 | response to desiccation | GO:0009269 | Biological Process | 0.0 | - |
| Sma3 | response to wounding | GO:0009611 | Biological Process | 0.0 | - |
| Sma3 | abscisic acid mediated signaling pathway | GO:0009738 | Biological Process | 0.0 | - |
| Sma3 | positive regulation of flavonoid biosynthetic process | GO:0009963 | Biological Process | 0.0 | - |
| Sma3 | response to chitin | GO:0010200 | Biological Process | 0.0 | - |
| Sma3 | regulation of transcription from RNA polymerase II promoter in response to oxidative stress | GO:0043619 | Biological Process | 0.0 | - |
| Sma3 | GO:0045449 | Biological Process | 0.0 | - | |
| Sma3 | GO:0045941 | Biological Process | 0.0 | - | |
| Sma3 | regulation of sequence-specific DNA binding transcription factor activity | GO:0051090 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | IPR001092 | - | 0.0 | - | |
| Sma3 | Helix-loop-helix DNA-binding | IPR011598 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G46760.1 | Basic helix-loop-helix (bHLH) DNA-binding family protein chr5:18974231-18976009 FORWARD LENGTH=592 | 1.0e-12 | 66% |
| RefSeq | Arabidopsis thaliana | NP_199488.1 | transcription factor ATR2 [Arabidopsis thaliana] | 1.0e-12 | 66% |
| RefSeq | Populus trichocarpa | XP_002329512.1 | predicted protein [Populus trichocarpa] | 4.0e-12 | 64% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B9VVN9
Fln msg: Distance to subject end: 128 aas, your sequence is shorter than subject: 56 - 660
Fln protein:
H
Protein Length:
57
Fln nts:
G
Fln Alignment:
GD4IA4403FQ6V0___NHSTECIKPLVPNVSKMDKASLLGDAISYINELRSKVQDSESHKKACRLNL
B9VVN9_______________NQRVYALRAVVPNVSKMDKASLLGDAIAYINELRSKVVDAETHKKELQVQV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
