UniGene Name: sp_v3.0_unigene78470
Length: 159 nt
![]() |
---|
>sp_v3.0_unigene78470
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | myosin 1 [Arabidopsis thaliana] emb|CAA82234.1| myosin [Arabidopsis thaliana] gb|AEE29607.1| myosin 1 [Arabidopsis thaliana] | - | - | 2.0e-05 | 64% |
FL-Next | tr=Putative uncharacterized protein; Vitis vinifera (Grape). | - | - | 0.0 | 64% |
Sma3 | Unconventional myosin heavy chain | - | - | 1.427e-07 | - |
Source | Gene names |
---|---|
Sma3 | 41C02.1; At1g17580; At2g31900; At5g20490; GSVIVT00003703001; GSVIVT00007440001; GSVIVT00016505001; GSVIVT00027091001; GSVIVT00027094001; GSVIVT00034148001; LOC_Os03g53660; MYO1; Ntmy170; OSJNBa0069E14.11; OSJNBb0024N19.13; Os06g0488200; OsI_23028; OsJ_125 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | myosin complex | GO:0016459 | Cellular Component | 0.0 | - |
Sma3 | motor activity | GO:0003774 | Molecular Function | 0.0 | - |
Sma3 | actin binding | GO:0003779 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
Sma3 | signal transducer activity | GO:0004871 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | actin filament binding | GO:0051015 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | signal transduction | GO:0007165 | Biological Process | 0.0 | - |
Sma3 | actin filament-based movement | GO:0030048 | Biological Process | 0.0 | - |
Sma3 | keratinization | GO:0031424 | Biological Process | 0.0 | - |
![]() |
---|
Fln status: Putative C-terminus
Fln database: tr_plants
Fln subject: D7U8K4
Fln msg: STOP codon was not found. Distance to subject end: 7 aas, your sequence is shorter than subject: 52 - 99
Fln protein:
L
Protein Length:
53
Fln nts:
A
Fln Alignment:
GD4IA4403G08G9___PFTVDDISKSVQDMNLSDVDPPPLLRQNSDF
D7U8K4_______________PFTVDDISKTMQQIKVFDIDPPPLIRENSGF
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain