|
||||||
|
UniGene Name: sp_v3.0_unigene78465
Length: 210 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene78465
A |
|
Ace file of the UniGene sp_v3.0_unigene78465
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | ATPase [Arabidopsis thaliana] | - | - | 2.0e-10 | 72% |
| FL-Next | sp=Phospholipid-transporting ATPase 1; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 63% |
| Sma3 | Aminophospholipid ATPase | - | - | 1.147e-13 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Phospholipid-translocating ATPase. | EC:3.6.3.1 | - | 1.565e-09 | - |
| Source | Gene names |
|---|---|
| Sma3 | ALA1; At5g04930; GSVIVT00001690001; GSVIVT00037503001; LOC_Os03g20958; LOC_Os03g20970; LOC_Os03g21680; MUG13.22; Os01g0277600; Os03g0326100; Os03g0326200; OsI_11389; OsI_11390; OsJ_10682; OsJ_10683; POPTRDRAFT_254443; POPTRDRAFT_560995; POPTRDRAFT_725358; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | magnesium ion binding | GO:0000287 | Molecular Function | 0.0 | - |
| Sma3 | phospholipid-translocating ATPase activity | GO:0004012 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism | GO:0015662 | Molecular Function | 0.0 | - |
| Sma3 | ATP biosynthetic process | GO:0006754 | Biological Process | 0.0 | - |
| Sma3 | phospholipid transport | GO:0015914 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | ATPase, P-type, K/Mg/Cd/Cu/Zn/Na/Ca/Na/H-transporter | IPR001757 | - | 0.0 | - |
| Sma3 | Haloacid dehalogenase-like hydrolase | IPR005834 | - | 0.0 | - |
| Sma3 | ATPase, P-type cation exchange, alpha subunit | IPR006069 | - | 0.0 | - |
| Sma3 | ATPase, P-type, phospholipid-translocating, flippase | IPR006539 | - | 0.0 | - |
| Sma3 | ATPase, P-type, ATPase-associated domain | IPR008250 | - | 0.0 | - |
| Sma3 | HAD superfamily hydrolase-like, type 3 | IPR013200 | - | 0.0 | - |
| Sma3 | ATPase, P-type phosphorylation site | IPR018303 | - | 0.0 | - |
| Sma3 | Formate C-acetyltransferase glycine radical, conserved site | IPR019777 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G04930.1 | ALA1 aminophospholipid ATPase 1 chr5:1445509-1449568 FORWARD LENGTH=1158 | 1.0e-12 | 72% |
| RefSeq | Arabidopsis thaliana | NP_568146.1 | phospholipid-transporting ATPase 1 [Arabidopsis thaliana] | 2.0e-12 | 72% |
| RefSeq | Populus trichocarpa | XP_002311927.1 | aminophospholipid ATPase [Populus trichocarpa] | 9.0e-13 | 75% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: P98204
Fln msg: Separated hits, possible frame ERROR between 100 and 102, Distance to subject end: 983 aas, your sequence is shorter than subject: 70 - 1158
Fln protein:
R
Protein Length:
71
Fln nts:
A
Fln Alignment:
GD4IA4403FQ1UR___IIIVLNQLPFLAVFGGVTSALPxLAFVLIVTAIKDGYEDWRRHRADRTENNRMANVWQD
P98204_______________VIAVLNQLPQLAVFGRGASIMPxLAFVLLVSAIKDAYEDFRRHRSDRVENNRLALVFED
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
