|
||||||
|
UniGene Name: sp_v3.0_unigene78412
Length: 154 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene78412
A |
|
Ace file of the UniGene sp_v3.0_unigene78412
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | ATP binding/protein serine/threonine kinase n=4 Tax=Magnoliophyta RepID=C6FF68_SOYBN | - | - | 2.0e-13 | 70% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 54% |
| Source | Gene names |
|---|---|
| Sma3 | AT2G01950; At2g01950; BRL1; F14H20.2; GSVIVT00030658001; LOC_Os10g02500; LRR-RLK; OJ1014H12.3; OSJNBa0092N12.12; Os10g0114400; OsI_32557; OsJ_34509; POPTRDRAFT_657034; POPTRDRAFT_658669; RCOM_0777790; VH1; VITISV_033419; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | auxin mediated signaling pathway | GO:0009734 | Biological Process | 0.0 | - |
| Sma3 | brassinosteroid mediated signaling pathway | GO:0009742 | Biological Process | 0.0 | - |
| Sma3 | phloem transport | GO:0010233 | Biological Process | 0.0 | - |
| Sma3 | leaf vascular tissue pattern formation | GO:0010305 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
| Sma3 | Leucine-rich repeat | IPR001611 | - | 0.0 | - |
| Sma3 | Phosphopantetheine attachment site | IPR006162 | - | 0.0 | - |
| Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
| Sma3 | Leucine-rich repeat-containing N-terminal, type 2 | IPR013210 | - | 0.0 | - |
| Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
| Sma3 | IPR017442 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G01950.1 | VH1, BRL2 BRI1-like 2 chr2:440805-444236 REVERSE LENGTH=1143 | 1.0e-14 | 62% |
| RefSeq | Arabidopsis thaliana | NP_178304.1 | serine/threonine-protein kinase BRI1-like 2 [Arabidopsis thaliana] | 2.0e-14 | 62% |
| RefSeq | Populus trichocarpa | XP_002312487.1 | predicted protein [Populus trichocarpa] | 7.0e-18 | 72% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: C0PSK3
Fln msg: Distance to subject end: 458 aas, your sequence is shorter than subject: 50 - 606
Fln protein:
N
Protein Length:
51
Fln nts:
A
Fln Alignment:
GD4IA4403FQWQZ___NDLMGNIPSEFGNMTALQVLELAHNNLTGSLPASLGKLRNLGVLDASHNR
C0PSK3_______________NHISGTLPSELGNMTSLRNLNLENNNLTGNIPSSLGQLRNLQYLVIRNNK
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
