UniGene Name: sp_v3.0_unigene78411
Length: 214 nt
UniGene Fasta |
---|
>sp_v3.0_unigene78411
G |
Ace file of the UniGene sp_v3.0_unigene78411 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Bergaptol O-methyltransferase n=1 Tax=Ammi majus RepID=BMT_AMMMJ | - | - | 6.0e-11 | 69% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 83% |
Sma3 | Caffeic acid 3-O-methyltransferase | - | - | 4.239e-15 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Caffeate O-methyltransferase. | EC:2.1.1.68 | - | 3.23e-14 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Phenylpropanoid biosynthesis | 00940 | 3.23e-14 | % | |
Sma3 | Biosynthesis of phenylpropanoids | 01061 | 3.23e-14 | % | |
Sma3 | Metabolic pathways | 01100 | 3.23e-14 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 3.23e-14 | % |
Source | Gene names |
---|---|
Sma3 | COMT; COMT1; COMT2; COMT4; COMT5; COMT6; GSVIVT00025990001; GSVIVT00036190001; GSVIVT00037164001; HOMT1; HOMT3; IMT1; MtrDRAFT_AC150443g26v2; OMT I-b; OMT1; OMT2; OSJNBa0039G19.11; OSJNBa0039G19.12; Omt II; Os04g0175900; OsI_15048; OsJ_13998; POPTRDRAFT_5 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | O-methyltransferase activity | GO:0008171 | Molecular Function | 0.0 | - |
Sma3 | catechol O-methyltransferase activity | GO:0016206 | Molecular Function | 0.0 | - |
Sma3 | inositol 4-methyltransferase activity | GO:0030787 | Molecular Function | 0.0 | - |
Sma3 | protein dimerization activity | GO:0046983 | Molecular Function | 0.0 | - |
Sma3 | caffeate O-methyltransferase activity | GO:0047763 | Molecular Function | 0.0 | - |
Sma3 | lignin biosynthetic process | GO:0009809 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | O-methyltransferase, family 2 | IPR001077 | - | 0.0 | - |
Sma3 | Winged helix-turn-helix transcription repressor DNA-binding | IPR011991 | - | 0.0 | - |
Sma3 | Plant methyltransferase dimerisation | IPR012967 | - | 0.0 | - |
Sma3 | O-methyltransferase, COMT, eukaryota | IPR016461 | - | 0.0 | - |
Sma3 | EF-Hand 1, calcium-binding site | IPR018247 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G54160.1 | ATOMT1, OMT1 O-methyltransferase 1 chr5:21982075-21984167 FORWARD LENGTH=363 | 5.0e-13 | 58% |
RefSeq | Arabidopsis thaliana | NP_200227.1 | Quercetin 3-O-methyltransferase 1 [Arabidopsis thaliana] | 7.0e-13 | 58% |
RefSeq | Populus trichocarpa | XP_002302676.1 | catechol o-methyltransferase [Populus trichocarpa] | 5.0e-15 | 69% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LQK0
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 84 aas, your sequence is shorter than subject: 71 - 395
Fln protein:
P
Protein Length:
72
Fln nts:
G
Fln Alignment:
GD4IA4403GO5ZF___PTIRGINLDLPHVIDTAPALPGVEHVRGNMFEHIPPADAVFLK
B8LQK0_______________PHIRGINLDLPHVIAGAPTLPGVEHVGGNMFEHIPPADAIFMK
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain