|
||||||
|
UniGene Name: sp_v3.0_unigene78382
Length: 195 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene78382
G |
|
Ace file of the UniGene sp_v3.0_unigene78382
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | pyruvate dehydrogenase E1 component subunit alpha [Arabidopsis thaliana] gb|AAB86803.1| pyruvate dehydrogenase E1 alpha subunit [Arabidopsis thaliana] gb|AAK96625.1| At1g01090/T25K16_8 [Arabidopsis thaliana] gb|AAL36074.1| At1g01090/T25K16_8 [Arabidopsis | - | - | 4.0e-10 | 60% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 76% |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Pyruvate dehydrogenase (acetyl-transferring). | EC:1.2.4.1 | - | 3.854e-07 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Glycolysis / Gluconeogenesis | 00010 | 3.854e-07 | % | |
| Sma3 | Citrate cycle (TCA cycle) | 00020 | 3.854e-07 | % | |
| Sma3 | Valine, leucine and isoleucine biosynthesis | 00290 | 3.854e-07 | % | |
| Sma3 | Pyruvate metabolism | 00620 | 3.854e-07 | % | |
| Sma3 | Butanoate metabolism | 00650 | 3.854e-07 | % | |
| Sma3 | Biosynthesis of phenylpropanoids | 01061 | 3.854e-07 | % | |
| Sma3 | Biosynthesis of terpenoids and steroids | 01062 | 3.854e-07 | % | |
| Sma3 | Biosynthesis of alkaloids derived from shikimate pathway | 01063 | 3.854e-07 | % | |
| Sma3 | Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid | 01064 | 3.854e-07 | % | |
| Sma3 | Biosynthesis of alkaloids derived from histidine and purine | 01065 | 3.854e-07 | % | |
| Sma3 | Biosynthesis of alkaloids derived from terpenoid and polyketide | 01066 | 3.854e-07 | % | |
| Sma3 | Biosynthesis of plant hormones | 01070 | 3.854e-07 | % | |
| Sma3 | Metabolic pathways | 01100 | 3.854e-07 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 3.854e-07 | % |
| Source | Gene names |
|---|---|
| Sma3 | At1g01090; PHYPADRAFT_220786; PHYPADRAFT_225446; RCOM_1339660; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
| Sma3 | intracellular membrane-bounded organelle | GO:0043231 | Cellular Component | 0.0 | - |
| Sma3 | nucleotide binding | GO:0000166 | Molecular Function | 0.0 | - |
| Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
| Sma3 | pyruvate dehydrogenase (acetyl-transferring) activity | GO:0004739 | Molecular Function | 0.0 | - |
| Sma3 | glycolysis | GO:0006096 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | RNA recognition motif domain | IPR000504 | - | 0.0 | - |
| Sma3 | Dehydrogenase, E1 component | IPR001017 | - | 0.0 | - |
| Sma3 | Nucleotide-binding, alpha-beta plait | IPR012677 | - | 0.0 | - |
| Sma3 | Pyruvate dehydrogenase (acetyl-transferring) E1 component, alpha subunit, subgroup y | IPR017597 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G01090.1 | PDH-E1 ALPHA pyruvate dehydrogenase E1 alpha chr1:47705-49166 REVERSE LENGTH=428 | 2.0e-14 | 60% |
| RefSeq | Arabidopsis thaliana | NP_171617.1 | pyruvate dehydrogenase E1 component subunit alpha [Arabidopsis thaliana] | 3.0e-14 | 60% |
| RefSeq | Populus trichocarpa | XP_002301442.1 | predicted protein [Populus trichocarpa] | 4.0e-13 | 57% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LRC3
Fln msg: Distance to subject end: 37 aas, your sequence is shorter than subject: 65 - 438
Fln protein:
G
Protein Length:
66
Fln nts:
G
Fln Alignment:
GD4IA4403FXND6___EKAHYAARDPIVSFRKYLIENNLANDTIGFEVN*KEIDEIIEDAVEFADASPLPQ
B8LRC3_______________EKAHYAARDPIVSLKKYLIENNLANESDLKSIE-KKIDEIIEEAVEFADASPLPQ
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
