|
||||||
|
UniGene Name: sp_v3.0_unigene78249
Length: 169 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene78249
A |
|
Ace file of the UniGene sp_v3.0_unigene78249 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Tetratricopeptide-like helical [Medicago truncatula] | - | - | 7.0e-18 | 78% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 80% |
| Sma3 | Pentatricopeptide, putative, expressed | - | - | 5.781e-10 | - |
| Source | Gene names |
|---|---|
| Sma3 | At1g04840; At1g08070; At1g09410; At1g11290; At1g18485; At1g20230; At2g22070; At3g02010; At3g11460; At3g12770; At3g14330; At3g22690; At3g23330; At3g24000; At3g26782; At3g46790; At3g49140; At3g56550; At3g57430; At3g63370; At4g16835; At4g30700; At4g33170; At |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
| Sma3 | ribosome | GO:0005840 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
| Sma3 | structural constituent of ribosome | GO:0003735 | Molecular Function | 0.0 | - |
| Sma3 | endonuclease activity | GO:0004519 | Molecular Function | 0.0 | - |
| Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
| Sma3 | methyltransferase activity | GO:0008168 | Molecular Function | 0.0 | - |
| Sma3 | acireductone synthase activity | GO:0043874 | Molecular Function | 0.0 | - |
| Sma3 | metal ion binding | GO:0046872 | Molecular Function | 0.0 | - |
| Sma3 | DNA methylation | GO:0006306 | Biological Process | 0.0 | - |
| Sma3 | translation | GO:0006412 | Biological Process | 0.0 | - |
| Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
| Sma3 | RNA modification | GO:0009451 | Biological Process | 0.0 | - |
| Sma3 | thylakoid membrane organization | GO:0010027 | Biological Process | 0.0 | - |
| Sma3 | photosystem II assembly | GO:0010207 | Biological Process | 0.0 | - |
| Sma3 | regulation of chlorophyll biosynthetic process | GO:0010380 | Biological Process | 0.0 | - |
| Sma3 | mRNA modification | GO:0016556 | Biological Process | 0.0 | - |
| Sma3 | L-methionine salvage from methylthioadenosine | GO:0019509 | Biological Process | 0.0 | - |
| Sma3 | chloroplast RNA processing | GO:0031425 | Biological Process | 0.0 | - |
| Sma3 | polycistronic mRNA processing | GO:0031426 | Biological Process | 0.0 | - |
| Sma3 | photosystem I assembly | GO:0048564 | Biological Process | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G57430.1 | OTP84 Tetratricopeptide repeat (TPR)-like superfamily protein chr3:21255731-21258403 REVERSE LENGTH=890 | 2.0e-22 | 74% |
| RefSeq | Arabidopsis thaliana | NP_191302.2 | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] | 3.0e-22 | 74% |
| RefSeq | Populus trichocarpa | XP_002330010.1 | predicted protein [Populus trichocarpa] | 1.0e-23 | 76% |
| Full-Lengther Next Prediction |
|---|
Fln status: C-terminus
Fln database: coniferopsida.fasta
Fln subject: D5ADG9
Fln msg: your sequence is shorter than subject: 51 - 312
Fln protein:
I
Protein Length:
52
Fln nts:
A
Fln Alignment:
GD4IA4403F7LEV___IQITKNLRVCKDCHIATKFISKIVRREIVLRDTKRFHYFRDGLCSCGDYW
D5ADG9_______________IRITKNLRVCGDCHSATKFISKIVKREIIMRDLNRFHHFKDGLCSCGDYW
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
