UniGene Name: sp_v3.0_unigene78181
Length: 209 nt
![]() |
---|
>sp_v3.0_unigene78181
T |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | oxidoreductase, 2OG-Fe(II) oxygenase family protein [Arabidopsis thaliana] gb|AAD03424.1| contains similarity to Iron/Ascorbate family of oxidoreductases (Pfam: PF00671, Score=307.1, E=2.2e-88, N=1) [Arabidopsis thaliana] emb|CAB40042.1| putative flavanon | - | - | 9.0e-18 | 61% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 60% |
Sma3 | 1-aminocyclopropane-1-carboxylate oxidase, putative | - | - | 6.972e-11 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Flavonol synthase. | EC:1.14.11.23 | - | 9.143e-12 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Flavonoid biosynthesis | 00941 | 9.143e-12 | % | |
Sma3 | Biosynthesis of phenylpropanoids | 01061 | 9.143e-12 | % | |
Sma3 | Metabolic pathways | 01100 | 9.143e-12 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 9.143e-12 | % | |
Sma3 | Flavanone 3-dioxygenase. | EC:1.14.11.9 | - | 2.525e-09 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Flavonoid biosynthesis | 00941 | 2.525e-09 | % | |
Sma3 | Biosynthesis of phenylpropanoids | 01061 | 2.525e-09 | % | |
Sma3 | Metabolic pathways | 01100 | 2.525e-09 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 2.525e-09 | % |
Source | Gene names |
---|---|
Sma3 | AT4g10490; AT4g10500; At4g10490; At4g10500; EFE; F3H7.16; F3H7.17; F7L13.70; F7L13.80; GSVIVT00000476001; GSVIVT00000477001; GSVIVT00019021001; GSVIVT00019022001; GSVIVT00026183001; GSVIVT00033948001; H0303A11-B0406H05.3; LOC_Os03g03034; OJ1126B12.4; OSJN |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Aminoacyl-tRNA synthetase, class I, conserved site | IPR001412 | - | 0.0 | - |
Sma3 | Isopenicillin N synthase | IPR002283 | - | 0.0 | - |
Sma3 | Oxoglutarate/iron-dependent oxygenase | IPR005123 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G10490.1 | 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein chr4:6483900-6485179 FORWARD LENGTH=348 | 8.0e-24 | 61% |
RefSeq | Arabidopsis thaliana | NP_192787.1 | oxidoreductase, 2OG-Fe(II) oxygenase family protein [Arabidopsis thaliana] | 1.0e-23 | 61% |
RefSeq | Populus trichocarpa | XP_002320903.1 | predicted protein, partial [Populus trichocarpa] | 5.0e-31 | 71% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9P1C4
Fln msg: Distance to subject end: 28 aas, your sequence is shorter than subject: 69 - 363
Fln protein:
F
Protein Length:
70
Fln nts:
T
Fln Alignment:
GD4IA4403FXPYZ___FVINIGDQLQVLSNGRYKSVLHRAVVSSSKPRISIPTFYSPSPDAIIGPAPASIDEEHPALFRRFAYEE
A9P1C4_______________FVVNMGDQLQVVSNGRFRSVEHRAVTNTSTARISIPTFYGPSEEAFIAPAESLVDEQHPALYKGFKFGE
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain