|
||||||
|
UniGene Name: sp_v3.0_unigene78158
Length: 188 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene78158
C |
|
Ace file of the UniGene sp_v3.0_unigene78158
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Laccase-like multicopper oxidase 130 (Fragment) n=1 Tax=Ginkgo biloba RepID=Q693D1_GINBI | - | - | 1.0e-20 | 67% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 88% |
| Sma3 | Laccase | - | - | 2.788e-30 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Laccase. | EC:1.10.3.2 | - | 0.0 | - |
| Sma3 | L-ascorbate oxidase. | EC:1.10.3.3 | - | 5.542e-25 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Ascorbate and aldarate metabolism | 00053 | 5.542e-25 | % | |
| Sma3 | Metabolic pathways | 01100 | 5.542e-25 | % |
| Source | Gene names |
|---|---|
| Sma3 | At2g30210; At2g40370; At3g09220; At5g05390; At5g07130; At5g09360; At5g48100; At5g60020; B1088C09.5; F3L24.9; GLac90; GSVIVT00001780001; GSVIVT00001781001; GSVIVT00006351001; GSVIVT00006357001; GSVIVT00006367001; GSVIVT00006369001; GSVIVT00006372001; GSVIV |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
| Sma3 | copper ion binding | GO:0005507 | Molecular Function | 0.0 | - |
| Sma3 | laccase activity | GO:0008471 | Molecular Function | 0.0 | - |
| Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
| Sma3 | lignin biosynthetic process | GO:0009809 | Biological Process | 0.0 | - |
| Sma3 | lignin catabolic process | GO:0046274 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Peptidase, cysteine peptidase active site | IPR000169 | - | 0.0 | - |
| Sma3 | Oxidoreductase, molybdopterin-binding domain | IPR000572 | - | 0.0 | - |
| Sma3 | Multicopper oxidase, type 1 | IPR001117 | - | 0.0 | - |
| Sma3 | Multicopper oxidase, copper-binding site | IPR002355 | - | 0.0 | - |
| Sma3 | Auxin efflux carrier | IPR004776 | - | 0.0 | - |
| Sma3 | Bacterial extracellular solute-binding family 1, conserved site | IPR006061 | - | 0.0 | - |
| Sma3 | Cupredoxin | IPR008972 | - | 0.0 | - |
| Sma3 | TonB box, conserved site | IPR010916 | - | 0.0 | - |
| Sma3 | Multicopper oxidase, type 2 | IPR011706 | - | 0.0 | - |
| Sma3 | Multicopper oxidase, type 3 | IPR011707 | - | 0.0 | - |
| Sma3 | Laccase | IPR017761 | - | 0.0 | - |
| Sma3 | Glycoside hydrolase, family 1, active site | IPR018120 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G40370.1 | LAC5 laccase 5 chr2:16858192-16860593 REVERSE LENGTH=580 | 1.0e-24 | 62% |
| RefSeq | Arabidopsis thaliana | NP_181568.1 | laccase 5 [Arabidopsis thaliana] | 2.0e-24 | 62% |
| RefSeq | Populus trichocarpa | XP_002329138.1 | predicted protein [Populus trichocarpa] | 7.0e-25 | 65% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: C0PRA7
Fln msg: Distance to subject end: 354 aas, your sequence is shorter than subject: 62 - 570
Fln protein:
L
Protein Length:
63
Fln nts:
C
Fln Alignment:
GD4IA4403FOGWJ___LYPFPKPHAEIPIIIGEWWNGDPIAVINEAISTGGAPNLSDAFTINGQPGDLYRCSRSETFR
C0PRA7_______________LYPFPKPRAEIPIIIGEWWNKDPITVINQAILTGGAPNLSDAFTINGQPGDLYPCSTSETFR
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
