UniGene Name: sp_v3.0_unigene78139
Length: 240 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene78139
C |
Ace file of the UniGene sp_v3.0_unigene78139
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Ubiquitin carrier protein (Fragment) n=1 Tax=Leucoagaricus gongylophorus RepID=E7D8R0_LEUGO | - | - | 4.0e-21 | 87% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 75% |
| Sma3 | Ubiquitin carrier protein | - | - | 2.20004e-43 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Ligases, Forming carbon-nitrogen bonds, Acid--D-amino-acid ligases (peptide synthases). | EC:6.3.2.- | - | 1.223e-40 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Tryptophan metabolism | 00380 | 1.223e-40 | % | |
| Sma3 | Biosynthesis of siderophore group nonribosomal peptides | 01053 | 1.223e-40 | % | |
| Sma3 | Ubiquitin--protein ligase. | EC:6.3.2.19 | - | 3.002e-14 | - |
| Source | Gene names |
|---|---|
| Sma3 | AT5G41700; AT5G53300; At1g64230; At2g16740; At3g08690; At3g08700; At4g27960; At5g41700; At5g53300; At5g56150; B0811B10.8; B1043F11.37; CHLREDRAFT_152525; CHLREDRAFT_160028; Elr; F17O14.16; F17O14.17; F22C12.2; GSVIVT00002469001; GSVIVT00006484001; GSVIVT0 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | ubiquitin-protein ligase activity | GO:0004842 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | small conjugating protein ligase activity | GO:0019787 | Molecular Function | 0.0 | - |
| Sma3 | ubiquitin-dependent protein catabolic process | GO:0006511 | Biological Process | 0.0 | - |
| Sma3 | modification-dependent protein catabolic process | GO:0019941 | Biological Process | 0.0 | - |
| Sma3 | post-translational protein modification | GO:0043687 | Biological Process | 0.0 | - |
| Sma3 | regulation of protein metabolic process | GO:0051246 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Ubiquitin-conjugating enzyme, E2 | IPR000608 | - | 0.0 | - |
| Sma3 | Ubiquitin-conjugating enzyme/RWD-like | IPR016135 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G56150.1 | UBC30 ubiquitin-conjugating enzyme 30 chr5:22729756-22730964 FORWARD LENGTH=148 | 4.0e-23 | 75% |
| RefSeq | Arabidopsis thaliana | NP_568835.1 | ubiquitin-conjugating enzyme E2 30 [Arabidopsis thaliana] | 5.0e-23 | 75% |
| RefSeq | Populus trichocarpa | XP_002330576.1 | predicted protein [Populus trichocarpa] | 5.0e-22 | 72% |
Full-Lengther Next Prediction |
|---|
Fln status: N-terminus
Fln database: coniferopsida.fasta
Fln subject: A9NLA0
Fln msg: Distance to subject end: 92 aas, your sequence is shorter than subject: 55 - 148
Fln protein:
M
Protein Length:
56
Fln nts:
C
Fln Alignment:
GD4IA4403GKCG5___MALKRINKELIDLGRDPPSSCSAGPVGDNMFSWQATIMGPTDSLYSGGVFFLTI
A9NLA0_______________MASKRIQKELQDLQRDPPTSCSAGPVGEDLFHWQATIMGPTDSPYAGGVFFVMI

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta