SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene78086

Length: 327 nt

UniGene Fasta

>sp_v3.0_unigene78086
TGGTATGCCACACCAACTTCAGTACCCTCGCAATGCGTGAGGAGGGTGGTATGAAGCACATCGAAGCCGCCATCGAAAAGCTTGCCCAGAAGCACGACGAGCACATCGCCGTTTACGGAGACGACAACGACATGCGTCTCACTGGTCGCCATGAGACCGGCCACATCGGTACTTTCAGCTCCGGTGTCGCCAACCGTGGTCTTCTATTCGTATCCCACGCCACGTCGCCGCCAAAGGCTATGGTTACTTGGAGGATAGGCGTCCTGCCTCCAACGTCGATCCTTACCGTGTCACCGGTATCATTGTTGAGACCACCGTCATCAACGC

Ace file of the UniGene sp_v3.0_unigene78086

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Glutamine synthetase n=1 Tax=Amanita muscaria RepID=GLNA_AMAMU	-	-	9.80909e-45	89%
FL-Next	sp=Glutamine synthetase; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	67%
Sma3	Glutamine synthetase	-	-	0.0	-

Source	ECs	Term	Type	e value	Identity
Sma3	Glutamate--ammonia ligase.	EC:6.3.1.2	-	0.0	-

Source	KEGGs	Term	Identity
Sma3	Alanine, aspartate and glutamate metabolism	00250	%
Sma3	Arginine and proline metabolism	00330	%
Sma3	Nitrogen metabolism	00910	%
Sma3	Metabolic pathways	01100	%

Source	Gene names
Sma3	AT5G35630; At1g48470; At1g66200; At3g17820; At5g16570; At5g35630; At5g37600; CHLREDRAFT_129468; CHLREDRAFT_136895; CsGS1; DtCGS-1; F15E12.14; GLN1; GLN1-1; GLN1-2; GLN1-3; GLN1-4; GLN1-5; GLN2; GLN3; GLN4; GLN5; GLN6; GLNA; GNL1; GNL2; GS; GS1; GS1-1; GS1

Source	GOs	Term	Type	Identity
Sma3	cell wall	GO:0005618	Cellular Component	-
Sma3	cytoplasm	GO:0005737	Cellular Component	-
Sma3	mitochondrion	GO:0005739	Cellular Component	-
Sma3	vacuole	GO:0005773	Cellular Component	-
Sma3	cytosol	GO:0005829	Cellular Component	-
Sma3	plasma membrane	GO:0005886	Cellular Component	-
Sma3	chloroplast	GO:0009507	Cellular Component	-
Sma3	chloroplast thylakoid membrane	GO:0009535	Cellular Component	-
Sma3	chloroplast stroma	GO:0009570	Cellular Component	-
Sma3	chloroplast envelope	GO:0009941	Cellular Component	-
Sma3	cytosolic ribosome	GO:0022626	Cellular Component	-
Sma3	apoplast	GO:0048046	Cellular Component	-
Sma3	glutamate-ammonia ligase activity	GO:0004356	Molecular Function	-
Sma3	copper ion binding	GO:0005507	Molecular Function	-
Sma3	protein binding	GO:0005515	Molecular Function	-
Sma3	glutamine biosynthetic process	GO:0006542	Biological Process	-
Sma3	nitrogen compound metabolic process	GO:0006807	Biological Process	-
Sma3	aging	GO:0007568	Biological Process	-
Sma3	nitrogen fixation	GO:0009399	Biological Process	-
Sma3	response to salt stress	GO:0009651	Biological Process	-
Sma3	ammonia assimilation cycle	GO:0019676	Biological Process	-
Sma3	nitrate assimilation	GO:0042128	Biological Process	-
Sma3	response to cadmium ion	GO:0046686	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Glutamine synthetase, catalytic domain	IPR008146	-	-
Sma3	Glutamine synthetase, beta-Grasp	IPR008147	-	-
Sma3	Glutamine synthetase/guanido kinase, catalytic domain	IPR014746	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT5G35630.1	GS2, GLN2, ATGSL1 glutamine synthetase 2 chr5:13831220-13833239 FORWARD LENGTH=430	8.0e-29	60%
RefSeq	Arabidopsis thaliana	NP_198413.1	glutamine synthetase [Arabidopsis thaliana]	1.0e-28	60%
RefSeq	Populus trichocarpa	XP_002306385.1	predicted protein [Populus trichocarpa]	4.0e-29	65%

Full-Lengther Next Prediction

Fln status: Putative C-terminus

Fln database: coniferopsida.fasta

Fln subject: C0PR48

Fln msg: ERROR#3, very serious frame error, Overlapping hits, possible frame ERROR between 200 and 200, STOP codon was not found. Distance to subject end: 0 aas, your sequence is shorter than subject: 108 - 355

Fln protein: VCHTNFSTLAMREEGGMKHIEAAIEKLAQKHDEHIAVYGDDNDMRLTGRHETGHIGTFSSGVANRxxSIRIPRHVAAKGYGYLEDRRPASNVDPYRVTGIIVETTVIN

Protein Length: 109

Fln nts: TGGTATGCCACACCAACTTCAGTACCCTCGCAATGCGTGAGGAGGGTGGTATGAAGCACATCGAAGCCGCCATCGAAAAGCTTGCCCAGAAGCACGACGAGCACATCGCCGTTTACGGAGACGACAACGACATGCGTCTCACTGGTCGCCATGAGACCGGCCACATCGGTACTTTCAGCTCCGGTGTCGCCAACCGTxxxxxxTCTATTCGTATCCCACGCCACGTCGCCGCCAAAGGCTATGGTTACTTGGAGGATAGGCGTCCTGCCTCCAACGTCGATCCTTACCGTGTCACCGGTATCATTGTTGAGACCACCGTCATCAACGC

Fln Alignment:

GD4IA4403F9TE1___HTNFSTLAMREEGGMKHIEAAIEKLAQKHDEHIAVYGDDNDMRLTGRHETGHIGTFSSGVANRGSSIRIPRHVAAKGYGYLEDRRPASNVDPYRVTGIIVETTVI
C0PR48_______________HTNYSTKSMREEGGIKVIKKAIEKLGLRHKEHISAYGEGNERRLTGRHETADINTFSWGVANRGASIRVGRDTEREGKGYFEDRRPASNMDPYIVTSMITETTIL

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain