|
||||||
|
UniGene Name: sp_v3.0_unigene77984
Length: 173 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene77984
C |
|
Ace file of the UniGene sp_v3.0_unigene77984 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Multidrug/pheromone exporter, MDR family, ABC transporter family n=1 Tax=Populus trichocarpa RepID=B9N9D8_POPTR | - | - | 6.0e-11 | 79% |
| FL-Next | tr=MDR-like ABC transporter; Taxus cuspidata (Japanese yew). | - | - | 0.0 | 82% |
| Sma3 | Multidrug resistance protein 1, 2, putative | - | - | 3.27e-24 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Phosphate-transporting ATPase. | EC:3.6.3.27 | - | 2.152e-17 | - |
| Sma3 | Xenobiotic-transporting ATPase. | EC:3.6.3.44 | - | 3.055e-20 | - |
| Source | Gene names |
|---|---|
| Sma3 | At1g02520; At1g02530; At2g47000; At3g62150; At4g01820; At4g18050; At5g46540; Cjmdr1; F14M4.17; F15J5.20; GSVIVT00003365001; GSVIVT00003368001; GSVIVT00003375001; GSVIVT00003377001; GSVIVT00019727001; GSVIVT00019729001; GSVIVT00028243001; K11I1.13; MDR16; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | xenobiotic-transporting ATPase activity | GO:0008559 | Molecular Function | 0.0 | - |
| Sma3 | ATPase activity, coupled to transmembrane movement of substances | GO:0042626 | Molecular Function | 0.0 | - |
| Sma3 | transport | GO:0006810 | Biological Process | 0.0 | - |
| Sma3 | gravitropism | GO:0009630 | Biological Process | 0.0 | - |
| Sma3 | auxin mediated signaling pathway | GO:0009734 | Biological Process | 0.0 | - |
| Sma3 | response to cytokinin stimulus | GO:0009735 | Biological Process | 0.0 | - |
| Sma3 | auxin efflux | GO:0010315 | Biological Process | 0.0 | - |
| Sma3 | basipetal auxin transport | GO:0010540 | Biological Process | 0.0 | - |
| Sma3 | root hair elongation | GO:0048767 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | ABC transporter, transmembrane domain | IPR001140 | - | 0.0 | - |
| Sma3 | F-box domain, cyclin-like | IPR001810 | - | 0.0 | - |
| Sma3 | ABC transporter-like | IPR003439 | - | 0.0 | - |
| Sma3 | AAA+ ATPase domain | IPR003593 | - | 0.0 | - |
| Sma3 | Leucine-rich repeat 2 | IPR013101 | - | 0.0 | - |
| Sma3 | IPR013596 | - | 0.0 | - | |
| Sma3 | ABC transporter, conserved site | IPR017871 | - | 0.0 | - |
| Sma3 | ABC transporter, integral membrane type 1 | IPR017940 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G62150.1 | PGP21 P-glycoprotein 21 chr3:23008755-23013579 REVERSE LENGTH=1296 | 1.0e-14 | 84% |
| RefSeq | Arabidopsis thaliana | NP_191774.2 | ABC transporter B family member 21 [Arabidopsis thaliana] | 2.0e-14 | 84% |
| RefSeq | Populus trichocarpa | XP_002331877.1 | multidrug/pheromone exporter, MDR family, ABC transporter family [Populus trichocarpa] | 3.0e-15 | 79% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: E6Y0T0
Fln msg: Distance to subject end: 926 aas, your sequence is shorter than subject: 57 - 1316
Fln protein:
V
Protein Length:
58
Fln nts:
C
Fln Alignment:
GD4IA4403GGUAH___VLTGGMSPGQASPCLNAFGAGQAAAYKMFETIDRKPEIDV
E6Y0T0_______________VLMGGMSLGQTSPSLNAFSAGRAAAYKMFETIDRKPVIDV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
